Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate N515DRAFT_2514 N515DRAFT_2514 iron complex transport system ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__Dyella79:N515DRAFT_2514 Length = 273 Score = 134 bits (336), Expect = 3e-36 Identities = 88/241 (36%), Positives = 128/241 (53%), Gaps = 8/241 (3%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 L ++ + YG +VL V+L G++ ALIGPNG GKS+LL + L P GT L Sbjct: 18 LEARDVHLHYGERRVLQAVNLRAQPGRVLALIGPNGAGKSSLLGVLAGALQPSVGTATLD 77 Query: 63 DNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVA 122 + + +LARR ++L Q G +E+ GR+P + R + D V A Sbjct: 78 GVALERWPATELARRRAMLSQRVQLGFGFRAEEVAMLGRSPHGATSSR--SADGRIVEEA 135 Query: 123 MNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQ-----NTP-VVLLDEPTTYLDINHQVD 176 + L R ELSGG++QR LA VLAQ + P +LLDEP LDI HQ + Sbjct: 136 LKAAGAWSLFGRNYLELSGGEQQRVQLARVLAQIWDCRDAPGWLLLDEPEAGLDIAHQHE 195 Query: 177 LMRLMGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFS 236 L+ +L QG V+AVLHDLN A+RY D + ++A G ++ G E+V+ +L ++ Sbjct: 196 LLAQARQLAGQGFGVIAVLHDLNLAARYADDVALLAQGRLVRHGGREQVLDAPMLSKIYG 255 Query: 237 V 237 + Sbjct: 256 L 256 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 273 Length adjustment: 25 Effective length of query: 230 Effective length of database: 248 Effective search space: 57040 Effective search space used: 57040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory