Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate N515DRAFT_1085 N515DRAFT_1085 D-methionine transport system ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__Dyella79:N515DRAFT_1085 Length = 336 Score = 158 bits (399), Expect = 2e-43 Identities = 95/252 (37%), Positives = 146/252 (57%), Gaps = 17/252 (6%) Query: 8 DLHKRYGSH----EVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 D+HK Y L+ SL A G+V IIG SG+GKST +R INLLE+P G IL++ Sbjct: 6 DVHKSYRVDGKDIPALQPFSLDIADGEVFGIIGHSGAGKSTLIRLINLLERPSGGSILID 65 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 E+ + D AL+A R R+ M+FQHFNL S T +NI P+ + G + Sbjct: 66 GTEMTALG--DAALRA--------QRRRIGMIFQHFNLLSSQTVADNIA-FPLRLAGETD 114 Query: 124 T-EAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDP 182 + + + + L +VG+ YP +SGG++QRV IARALA P ++L DE TSALDP Sbjct: 115 AGKIKARVDELLRRVGLEAHASKYPAQLSGGQKQRVGIARALANRPSILLCDEATSALDP 174 Query: 183 ELVGDVLKVMQALAQEGR-TMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQ 241 + VL+++ + +E + T+V++THEM R V +++ L G + E G +V ++P+ Sbjct: 175 QTTASVLELLAEINRELKLTIVLITHEMDVVRRVCDRVAVLDAGRIVEHGAVADVFLHPR 234 Query: 242 SERLQQFLSGSL 253 ++F++ +L Sbjct: 235 HPTTRRFVNEAL 246 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 336 Length adjustment: 26 Effective length of query: 228 Effective length of database: 310 Effective search space: 70680 Effective search space used: 70680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory