Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate N515DRAFT_1085 N515DRAFT_1085 D-methionine transport system ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__Dyella79:N515DRAFT_1085 Length = 336 Score = 160 bits (404), Expect = 4e-44 Identities = 101/250 (40%), Positives = 142/250 (56%), Gaps = 16/250 (6%) Query: 32 IHKRYG----EHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITLDG 87 +HK Y + L+ SL+ G+V +IG SG+GKST++R IN LE+P G I +DG Sbjct: 7 VHKSYRVDGKDIPALQPFSLDIADGEVFGIIGHSGAGKSTLIRLINLLERPSGGSILIDG 66 Query: 88 ISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVSAAE 147 + G A RA R R+ M+FQHFNL S TV +NI R + A + Sbjct: 67 TEMTAL-GDAALRAQ--------RRRIGMIFQHFNLLSSQTVADNIAFPLRLAGETDAGK 117 Query: 148 AEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDPEL 207 + R L +VGL + A +YPA LSGGQ+QRV IARALA P I+L DE TSALDP+ Sbjct: 118 IKARVDELLRRVGLEAH-ASKYPAQLSGGQKQRVGIARALANRPSILLCDEATSALDPQT 176 Query: 208 VGEVLKVIQTLAEEGR-TMLMVTHEMGFARQVSSQVLFLHQGRVEEHGD-ARILDQPNSE 265 VL+++ + E + T++++THEM R+V +V L GR+ EHG A + P Sbjct: 177 TASVLELLAEINRELKLTIVLITHEMDVVRRVCDRVAVLDAGRIVEHGAVADVFLHPRHP 236 Query: 266 RLQQFLSNRL 275 ++F++ L Sbjct: 237 TTRRFVNEAL 246 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 336 Length adjustment: 27 Effective length of query: 249 Effective length of database: 309 Effective search space: 76941 Effective search space used: 76941 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory