Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate N515DRAFT_3308 N515DRAFT_3308 acetylornithine/N-succinyldiaminopimelate aminotransferase
Query= BRENDA::O30508 (406 letters) >FitnessBrowser__Dyella79:N515DRAFT_3308 Length = 411 Score = 368 bits (945), Expect = e-106 Identities = 193/393 (49%), Positives = 258/393 (65%), Gaps = 3/393 (0%) Query: 15 RYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAHPALVKALTEQAQRI 74 RY +P Y P + G+G+RVWD GR+ +D GIAV +LGH P LV AL QA+++ Sbjct: 16 RYWLPVYRPREVVLDHGKGARVWDTEGRDYVDLGAGIAVNALGHQDPDLVDALVTQARKL 75 Query: 75 WHVSNVFTNEPALRLARKLVDAT-FAERVFLANSGAEANEAAFKLARRYA-NDVYGPQKY 132 WH SNVF EP L LA +LV A+ FAERVFL NSG EANEAA KL R++A + P++ Sbjct: 76 WHSSNVFYTEPPLHLAEELVQASGFAERVFLCNSGTEANEAAIKLVRKWAASKGRAPEQR 135 Query: 133 EIIAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISD-KTCAVV 191 I+ SFHGRTL V QPKY + + P G ++ +ND+ L+AA + AV+ Sbjct: 136 VILTFRGSFHGRTLAAVTATAQPKYQENYEPLPGGFRYLDFNDVAGLEAAFAQGDVAAVM 195 Query: 192 LEPIQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHYGVVPDIL 251 LEP+QGEGGVLPA A++ AR+LCD H ALLV DE+Q GMGR G LFA+ GV PDI+ Sbjct: 196 LEPVQGEGGVLPASPAFIRRARELCDTHEALLVLDEIQCGMGRTGTLFAHAQDGVTPDIV 255 Query: 252 SSAKSLGGGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGV 311 + AK+LG GFPIGAML ++A+ + G HGTT+GGNP+A+AVA AL + + E++ V Sbjct: 256 TLAKALGCGFPIGAMLAGPKVAEVMQYGAHGTTFGGNPMAAAVARVALRKLASAELMANV 315 Query: 312 KAKHERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQA 371 + + + L I E +F E+RG GL++GA L + +KG+A +VL+ A ++VLQA Sbjct: 316 AKQAQALRDGLAAIDGELKLFAEVRGRGLMLGAVLAEAYKGRAGEVLDHAAAHGLLVLQA 375 Query: 372 SPDVVRFAPSLVIDDAEIDEGLERFERAVAKLV 404 PDV+RF P L I DA++ EGL R A+A V Sbjct: 376 GPDVLRFVPPLNITDADLAEGLARLRAALADFV 408 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 411 Length adjustment: 31 Effective length of query: 375 Effective length of database: 380 Effective search space: 142500 Effective search space used: 142500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory