Align Gamma-glutamyl-putrescine synthetase (EC 6.3.1.11) (characterized)
to candidate N515DRAFT_3024 N515DRAFT_3024 L-glutamine synthetase (EC 6.3.1.2)
Query= reanno::BFirm:BPHYT_RS23160 (444 letters) >FitnessBrowser__Dyella79:N515DRAFT_3024 Length = 469 Score = 122 bits (307), Expect = 2e-32 Identities = 117/399 (29%), Positives = 175/399 (43%), Gaps = 48/399 (12%) Query: 66 GVTDPDMVCVPDASTIRMIPWAVDPTAQVIHDCVHFDGTPVAIS--PRRVLRRVLELYKA 123 G+ + DM+ +PD T + P++ T V+H V T A PR + +R K+ Sbjct: 60 GINESDMILLPDPDTAYLDPFS-GHTQLVLHCDVLEPSTMQAYGRDPRSIAKRGEAFLKS 118 Query: 124 KGWKPV--IAPELEFYLVDMNKDPDLPLQPPIGR----------------------TG-R 158 G PE EF++ D + Q +GR TG R Sbjct: 119 TGIADTAFFGPEPEFFIFD-----SVRWQNDMGRVFYEIGSEEASWSSRYKYEDNNTGHR 173 Query: 159 PETGRQAYSIEAVNEFDPLFEDIYEYCEVQELEVDTLIHEVG-AAQMEINFMHGDPLKLA 217 P + + V+ L D+ + E V+ HEV A Q EI ++ A Sbjct: 174 PGVKGGYFPVSPVDSLGDLRADMCKVLESLGQVVEVHHHEVANAGQCEIGVKFNTLVQKA 233 Query: 218 DSVFLFKRTVREAALRHKMYATFMAKPMEGEPGSAMHMHQSLVDEETGHNLFTGP-DGKP 276 D + K ++ A ++ ATFM KP+ G+ GS MH+HQSL + G NLF G G Sbjct: 234 DELMTMKYVIKNVAHQNGKTATFMPKPIVGDNGSGMHVHQSLAKD--GKNLFAGDLYGGL 291 Query: 277 TSLFTSYIAGLQKYTPALMPIFAPYINSYRRLSRFMAAPINVAWGYDNRTVGFRIPH-SG 335 + YI G+ K+ A+ NSY+RL AP+ +A+ NR+ RIP+ S Sbjct: 292 SQTALWYIGGIFKHAKAINAFANSTTNSYKRLVPGFEAPVMLAYSARNRSASCRIPYVSN 351 Query: 336 PAARRIENRIPGVDCNPYLAIAATLAAGYLGMTQKLEATEPLLSDGYELPYQLPRNLEEG 395 P RRIE R P + YL A + AG G+ K++ P D Y+LP + +N+ + Sbjct: 352 PKGRRIEVRFPDPMNSGYLVFTALMMAGLDGIINKIDPGAPADKDLYDLPPEEEKNIPQV 411 Query: 396 L-TLMGACEPIAE---------VLGEKFVKAYLALKETE 424 +L A E + + V + F+ AY+ALK E Sbjct: 412 CSSLDQALEALDKDRDFLKAGGVFTDDFIDAYIALKMQE 450 Lambda K H 0.321 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 444 Length of database: 469 Length adjustment: 33 Effective length of query: 411 Effective length of database: 436 Effective search space: 179196 Effective search space used: 179196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory