GapMind for catabolism of small carbon sources

 

Aligments for a candidate for puuC in Dyella japonica UNC79MFTsu3.2

Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate N515DRAFT_4232 N515DRAFT_4232 L-proline dehydrogenase /delta-1-pyrroline-5-carboxylate dehydrogenase

Query= metacyc::MONOMER-11560
         (497 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_4232 N515DRAFT_4232 L-proline
            dehydrogenase /delta-1-pyrroline-5-carboxylate
            dehydrogenase
          Length = 1074

 Score =  164 bits (414), Expect = 2e-44
 Identities = 138/453 (30%), Positives = 205/453 (45%), Gaps = 15/453 (3%)

Query: 33   SGETFECLSPVDGR-FLAKVASCDLADANRAVENARATFNSGVWSQLAPAKRKAKLIRFA 91
            +G T +  +P D R  +    S D A   +A+ NA A  +   W +L  A R A L   A
Sbjct: 592  AGATVQVTNPADRRQVVGSYVSADSATVEKALANAVAAQHG--WDRLPAASRAAILEHAA 649

Query: 92   DLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYD--EVAPTPHDQ 149
            + L     E   L   + GK + D+ + +I  AA  + + A    + +   E  P P  +
Sbjct: 650  EQLEARRGEFIALCVREAGKGLPDAIA-EIREAADFLRYYATMARRYFGQPEQLPGPTGE 708

Query: 150  LGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEKSPLTAIRIAQLAIE 209
               +     GV   I PWNFPL +   ++  ALA GNSV+ KP+E++ L      QL  E
Sbjct: 709  SNQLFLNGRGVFVCISPWNFPLAIFLGQVAAALAAGNSVIAKPAEQTSLIGHAAVQLLHE 768

Query: 210  AGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQL--MVYAGESNMKRIWLE 267
            AG+PA VL  LPG G TVG AL     V  + FTGST+ A  +   + A  + +  +  E
Sbjct: 769  AGVPADVLQYLPGDGATVGAALTRDPRVAGVAFTGSTETAWAINRALAARNAPIAALIAE 828

Query: 268  AGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDKFLPMVVEALK 327
             GG++  I  + A   Q   +A +SA   + G+ C+A   L V+  I DK   M+  A+ 
Sbjct: 829  TGGQNAMIADSSALPEQIVKDAVSSAFQ-SAGQRCSAARVLYVQEDIADKVCAMLAGAMA 887

Query: 328  GWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTLEETGGTYVEPTI 387
              K G+P    T VG ++D      ++ +     ++  K+            GT+  P  
Sbjct: 888  ELKVGDPAQLSTDVGPVIDEDARKILVDHAARMDQEAKKIGEVALDPATTGNGTFFAPRA 947

Query: 388  FDGVTNAMRIAQEEIFGPVLSVIAFDTAE--EAVAIANDTPYGLAAGIWTSDISKAHKTA 445
            ++     +     EIFGPVL VI +  +E  + V   N T YGL  GI +          
Sbjct: 948  YE--IPGLATLTREIFGPVLHVIRWKGSELDKVVDEINATGYGLTLGIHSRIDDTVEFIQ 1005

Query: 446  RAVRAGSVWVNQYDGGDMTA--PFGGFKQSGNG 476
               R G+ +VN+   G +    PFGG   SG G
Sbjct: 1006 SRARVGNCYVNRNQIGAVVGVQPFGGEGLSGTG 1038


Lambda     K      H
   0.316    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1107
Number of extensions: 56
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 497
Length of database: 1074
Length adjustment: 40
Effective length of query: 457
Effective length of database: 1034
Effective search space:   472538
Effective search space used:   472538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory