GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupG in Dyella japonica UNC79MFTsu3.2

Align Xanthosine permease; Xanthosine transporter (characterized)
to candidate N515DRAFT_2002 N515DRAFT_2002 MFS transporter, NHS family, xanthosine permease

Query= SwissProt::P45562
         (418 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_2002 N515DRAFT_2002 MFS
           transporter, NHS family, xanthosine permease
          Length = 420

 Score =  471 bits (1212), Expect = e-137
 Identities = 232/412 (56%), Positives = 303/412 (73%), Gaps = 4/412 (0%)

Query: 1   MSIAMRLKVMSFLQYFIWGSWLVTLGSYMINTLHFTGANVGMVYSSKGIAAIIMPGIMGI 60
           MSI +RL +M FLQYF+WGSWL+T+G+Y     H+ G   G ++S+ GIA++ MP I G+
Sbjct: 1   MSIKLRLVIMYFLQYFVWGSWLLTIGAYWFQNKHWPGTQFGAIFSTMGIASLFMPSIAGV 60

Query: 61  IADKWLRAERAYMLCHLVCAGVLFYAASVTDPDMMFWVMLVNAMAFMPTIALSNSVSYSC 120
           IADKW+ AE+   L H+  A +LF   ++  P +MFWVML+N M +MPTI+LS +V+Y+ 
Sbjct: 61  IADKWINAEKLLGLMHIGGAIMLFVVPAIDSPGLMFWVMLLNMMFYMPTISLSIAVAYNA 120

Query: 121 LAQAGLDPVTAFPPIRVFGTVGFIVAMWAVSLLHLELSSLQLYIASGASLLLSAYALTLP 180
           L  +G D VT FPPIRV+GTVGFI A+W VSLLHLE ++ Q ++A  A+LLL  YA TLP
Sbjct: 121 LKSSGEDIVTVFPPIRVWGTVGFIAALWTVSLLHLETTAGQFHVAGAAALLLGLYAFTLP 180

Query: 181 KIPVA-EKKATTSLASKLGLDAFVLFKNPRMAIFFLFAMMLGAVLQITNVFGNPFLHDFA 239
           K P   E+K   SL   LGL +F L +N +MAIFF+FAM+LGA LQ+TN +G+ FLHDFA
Sbjct: 181 KCPPRFERKEQQSLLDTLGLTSFALLRNTQMAIFFMFAMLLGAALQLTNAYGDTFLHDFA 240

Query: 240 RNPEFADSFVVKYPSILLSVSQMAEVGFILTIPFFLKRFGIKTVMLMSMVAWTLRFGFFA 299
               + +   V+YP+I++S+SQ++E  FIL IPFFLKRFGIKTVML+SM+AWTLRFG FA
Sbjct: 241 AMEPYKNLIAVRYPAIIMSISQISETLFILAIPFFLKRFGIKTVMLISMLAWTLRFGLFA 300

Query: 300 YGDPSTTGFILLLLSMIVYGCAFDFFNISGSVFVEQEVDSSIRASAQGLFMTMVNGVGAW 359
           YGDP   G  +++LS IVYG AFDFFNISGS+FVE + D SIRASAQGLFM M NG+GA 
Sbjct: 301 YGDPG-AGLWMIVLSCIVYGMAFDFFNISGSLFVEGQADPSIRASAQGLFMLMTNGIGAV 359

Query: 360 VGSILSGMAVDYF--SVDGVKDWQTIWLVFAGYALFLAVIFFFGFKYNHDPE 409
           +GS +SG  +D F    DG K+W  IW+ F+ Y+L +AV+F F FK+ HDP+
Sbjct: 360 LGSSVSGWMIDAFFTQADGSKNWHGIWITFSLYSLIVAVLFVFLFKHKHDPK 411


Lambda     K      H
   0.330    0.141    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 567
Number of extensions: 33
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 418
Length of database: 420
Length adjustment: 32
Effective length of query: 386
Effective length of database: 388
Effective search space:   149768
Effective search space used:   149768
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory