Align Ribokinase (EC 2.7.1.15) (characterized)
to candidate N515DRAFT_3101 N515DRAFT_3101 ribokinase
Query= reanno::pseudo5_N2C3_1:AO356_00950 (304 letters) >FitnessBrowser__Dyella79:N515DRAFT_3101 Length = 297 Score = 225 bits (573), Expect = 1e-63 Identities = 135/301 (44%), Positives = 179/301 (59%), Gaps = 11/301 (3%) Query: 3 AKVVVIGSLNMDLVTRAPRLPRGGETLIGESFATIPGGKGANQAVAAARLGAQVSMVGCV 62 A+VVV+GS+NMDLVT APR GET++GE F T+PGGKGANQAVAAARLGA+V+++G + Sbjct: 2 ARVVVVGSINMDLVTLAPRFAGPGETVLGERFLTVPGGKGANQAVAAARLGAEVTLIGAL 61 Query: 63 GDDAYGEQLRGALLAEGIDCQAV-RVEQGSSGVALIVVDDNSQNAIVIVAGANGALTAEV 121 GDD +GEQLR L EGI V R++ SG A I V +N I++V AN +T Sbjct: 62 GDDTFGEQLREGLAREGIALDYVSRIDDCGSGTASITV-AGGENEIIVVPAANARVTPAQ 120 Query: 122 LDGVDDVLQSADVIICQLEVPDATVGHALKRGRALGKIVILNPAPASHALPADWYACIDY 181 ++ D + AD ++ Q+E+P +V L+ G LG VILNPAPA LP +W Y Sbjct: 121 VEAATDAIARADAVLVQMEIPLESVEATLRLGHRLGVPVILNPAPA-QKLPTEWLKLARY 179 Query: 182 LIPNESEAAVLSGLAVDSLETAEAAAAHLIAAGAGKVIVTLGAQGLMFANGASFEHFPAP 241 + PN+ E A+L L D+ + A L+ G V++T G +G + H Sbjct: 180 VTPNQHELAIL--LGADAQQDFRA----LMRQAPGPVVLTRGGEGAWYREDGEPTHQSGF 233 Query: 242 RVKAVDTTAAGDTFVGGFAAALACGKSEVDAIRFGQVAAALSVTRAGAQPSIPTLLEVQA 301 V VDTT AGDTF G A L G + A+R AAALSVTR GAQ +PT +E+ A Sbjct: 234 AVDVVDTTGAGDTFNGALAVFLHEGLPQ--AVRKACAAAALSVTRLGAQGGMPTRVELDA 291 Query: 302 F 302 + Sbjct: 292 W 292 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 297 Length adjustment: 27 Effective length of query: 277 Effective length of database: 270 Effective search space: 74790 Effective search space used: 74790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate N515DRAFT_3101 N515DRAFT_3101 (ribokinase)
to HMM TIGR02152 (rbsK: ribokinase (EC 2.7.1.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02152.hmm # target sequence database: /tmp/gapView.30600.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02152 [M=298] Accession: TIGR02152 Description: D_ribokin_bact: ribokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-100 320.3 0.1 6.9e-100 320.2 0.1 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 N515DRAFT_3101 ribokinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 N515DRAFT_3101 ribokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 320.2 0.1 6.9e-100 6.9e-100 1 297 [. 4 290 .. 4 291 .. 0.98 Alignments for each domain: == domain 1 score: 320.2 bits; conditional E-value: 6.9e-100 TIGR02152 1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlgaevsmigkvGkDefgee 66 +vvvGSin+Dlv+ ++r++ pGetv +e f +++GGKGANQAvaaarlgaev++ig++G+D+fge+ lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 4 VVVVGSINMDLVTLAPRFAGPGETVLGERFLTVPGGKGANQAVAAARLGAEVTLIGALGDDTFGEQ 69 79**************************************************************** PP TIGR02152 67 llenlkkegidteyvkkvkktstGvAlilvdeegeNsIvvvaGaneeltpedvkaaeekikesdlv 132 l+e l++egi +yv++++++ +G+A i+v+ geN+I+vv an+++tp++v+aa+++i+++d v lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 70 LREGLAREGIALDYVSRIDDCGSGTASITVAG-GENEIIVVPAANARVTPAQVEAATDAIARADAV 134 *******************************9.********************************* PP TIGR02152 133 llQlEipletveealkiakkagvkvllnPAPaekkldeellslvdiivpNetEaeiLtgievedle 198 l+Q+Eiple+ve+ l++ ++ gv v+lnPAPa+k l++e+l+l+ +++pN++E++iL+g lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 135 LVQMEIPLESVEATLRLGHRLGVPVILNPAPAQK-LPTEWLKLARYVTPNQHELAILLGA------ 193 ********************************66.9***********************9...... PP TIGR02152 199 daekaaekllekgvkaviitlGskGallvskdekklipalkvkavDttaAGDtFigalavaLaegk 264 da++ ++l++++ v++t G +Ga + + +e ++ + + v++vDtt+AGDtF+galav L+eg lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 194 DAQQDFRALMRQAPGPVVLTRGGEGAWYREDGEPTHQSGFAVDVVDTTGAGDTFNGALAVFLHEG- 258 68899999999999*************************************************99. PP TIGR02152 265 sledavrfanaaaalsVtrkGaqssiPtkeeve 297 l +avr+a aaaalsVtr+Gaq ++Pt+ e++ lcl|FitnessBrowser__Dyella79:N515DRAFT_3101 259 -LPQAVRKACAAAALSVTRLGAQGGMPTRVELD 290 .8899************************9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.58 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory