Align cytochrome c component of deoxyribose dehydrogenase (characterized)
to candidate N515DRAFT_2297 N515DRAFT_2297 Cytochrome c, mono- and diheme variants
Query= reanno::WCS417:GFF2133 (447 letters) >FitnessBrowser__Dyella79:N515DRAFT_2297 Length = 441 Score = 245 bits (625), Expect = 2e-69 Identities = 145/443 (32%), Positives = 221/443 (49%), Gaps = 35/443 (7%) Query: 13 LALPCLVAAGLLA-----WYVTREPATPFEQEQAGATFEPAL---VSRGEYVARLSDCVA 64 LAL +V G A W++ + + A A +L V+RGEY+ R +DC A Sbjct: 8 LALIAIVVVGAAAFTAYAWFIVGDGKETGAPQPAAAGAPASLTDPVARGEYLTRAADCAA 67 Query: 65 CHSLAGKAPFAGGLEMATPLGAIHATNITPDKSTGIGTYSLADFDRAVRHGVAPGGRRLY 124 CH++ G P+ GG+ P G I++TNIT DK TGIG +S +F RA+ GV G+ LY Sbjct: 68 CHTVPGGQPYTGGVAFKMPFGTIYSTNITADKETGIGDWSDDEFVRALHAGVRKDGKPLY 127 Query: 125 PAMPYPSYVKLSDDDIKALYAFFMQGIKPANQPNIPSDIPWPLNMRWPIALWNGVFAPTA 184 PA PY SY LS DD+ A+ A+ + P + P P+++ +P + RW +++WN +F Sbjct: 128 PAFPYTSYTALSRDDVLAIKAYLF-SLPPKHAPARPNELSFPFDQRWGLSVWNALFLKKQ 186 Query: 185 TYAAKPDQDALWNRGAYIVQGPGHCGSCHTPRGLAFNEKALDEAGAPFLAGALLDGWYAP 244 Y + WNRGAY+ GHC CHTPR + K D L+G +L GW A Sbjct: 187 RYEPVQGKSQAWNRGAYLATALGHCDECHTPRNAMYALKRGDA-----LSGEVLQGWKAY 241 Query: 245 SLRQDPNTGLGRWSEPQIVQFLKTGR-NAHAVVYGSMTEAFNNSTQFMQDDDLAAIARYL 303 ++ D G+G WSE Q+ +L G + G M E S Q++ +D+ A+ YL Sbjct: 242 NITSDKTYGIGNWSEQQLADYLSKGHASGRGTASGPMGEVVQYSLQYLTPEDIGALVTYL 301 Query: 304 KSLPGDPQRDGAPWQYQ-----AVAAVQDAPGA----------HTYATRCASCHGLDGKG 348 + + PQ+ A + A+A+ APGA H + C+SCH +G+G Sbjct: 302 REV--KPQQGSAGSEVNDRPALALASSASAPGAEELAQGGLGQHLFQGACSSCHLWNGQG 359 Query: 349 QPEWMPPLAGATSALAKESASAINITLNGSQRVVASGVPDAYRMPAFREQLSDTEIAEVL 408 + L G +A ++ + + L GS A G MP+F + +D E+A + Sbjct: 360 RQSEAAALLGTQAANDPQAHNLTQVILQGSTLRTAHGETS---MPSFGQAYTDAEVAALG 416 Query: 409 SYVRSTWGNNGGAVDANAVGKLR 431 ++V + +G + A+ V K R Sbjct: 417 NFVLTHFGGKPATLTADEVAKRR 439 Lambda K H 0.318 0.133 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 630 Number of extensions: 46 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 447 Length of database: 441 Length adjustment: 32 Effective length of query: 415 Effective length of database: 409 Effective search space: 169735 Effective search space used: 169735 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory