Align Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale)
to candidate N515DRAFT_2414 N515DRAFT_2414 simple sugar transport system permease protein
Query= uniprot:B2T9V8 (351 letters) >FitnessBrowser__Dyella79:N515DRAFT_2414 Length = 358 Score = 137 bits (344), Expect = 6e-37 Identities = 104/331 (31%), Positives = 162/331 (48%), Gaps = 17/331 (5%) Query: 22 ALPASRGKRARSELARLRELALLPALALLIVIGAFISPSFLTK--------ANLISVLGA 73 A+ + G+ R LA LL + LL G F +P FL NLI + Sbjct: 13 AISSRWGRGLRRCLAHPLLWPLLTLILLLAGNGLF-NPGFLALQWRDGHLYGNLIDIAHR 71 Query: 74 SAALALVVLAESLIVLTGKFDLSLESTVGIAPAVGAMLVMPAASAGFGMQWPAAAGLLAI 133 +A LALV L +L++ D+S+ + + IA V A + ++ G W A A LA Sbjct: 72 AAPLALVSLGMTLVIALRGLDISVGAVLAIAATVAAWTIGHVSNDGLLPLWLAIAAALA- 130 Query: 134 VVVGAVIGFINGFLVVRLRLNAFIVTLAMLIVLRGMLVGATKGG--TLFDMPTSFFALAT 191 GA+ G NG+LVV + + TL +++ RG+ + G TL+ P SF L Sbjct: 131 --AGALCGLWNGWLVVGAGMQPIVATLILMVAGRGIAQSISGGQILTLYYAPYSF--LGN 186 Query: 192 TIVLGLPLSVWLAAAAFAIAAFMLRYHRLGRALYAIGGNPEAARAAGIRVERITWGVFVL 251 VLGLP S+++ AA FA+ LR LG + AIG NP+AA AG+R IT G +V Sbjct: 187 GFVLGLPFSLFVVAAVFALLQLALRKTALGLFVRAIGHNPQAAHVAGVRARAITLGAYVF 246 Query: 252 GSILASVGGLIVTGYVGAINANQGNGMI-FTVFAAAVIGGISLDGGKGTMFGALTGVLLL 310 I A++ GL+V+ V + +AN ++ A +GG L GG+ ++ G+L G L++ Sbjct: 247 CGIAAALAGLLVSSNVNSADANNAGLLLELDAILAVALGGSLLGGGRFSLAGSLLGALII 306 Query: 311 GVVQNLLTLAQVPSFWIQAIYGAIILGSLMV 341 + + VP A+ ++ +++ Sbjct: 307 QALTTTIYAIGVPPQVNLAVKAVLVFAVMLL 337 Lambda K H 0.326 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 358 Length adjustment: 29 Effective length of query: 322 Effective length of database: 329 Effective search space: 105938 Effective search space used: 105938 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory