GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fucDH in Dyella japonica UNC79MFTsu3.2

Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate N515DRAFT_2873 N515DRAFT_2873 3-oxoacyl-[acyl-carrier-protein] reductase

Query= SwissProt::Q8P3K4
         (300 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_2873 N515DRAFT_2873
           3-oxoacyl-[acyl-carrier-protein] reductase
          Length = 247

 Score =  125 bits (314), Expect = 1e-33
 Identities = 85/246 (34%), Positives = 127/246 (51%), Gaps = 18/246 (7%)

Query: 63  LITAAGAGIGRESALACARAGAHVIATDIDA-----AALQALAAESD-AITTQLLDVTDA 116
           ++T    G+G E     A AG  VIA D+ A     AA QA  A+ D A+  + +DV+D 
Sbjct: 6   IVTGGIGGLGTEICRQLALAGRQVIAADLPARADRVAAFQAELADLDGAVRFEPVDVSDF 65

Query: 117 AAITALVA----AHGPFDVLFNCAGYVHQGSILDCDEPAWRRSFSINVDAMYYTCKAVLP 172
           A+ + L+A    AHG  DVL N AG     ++   D   W+    +N+D ++  C+ V+ 
Sbjct: 66  ASCSELIARVEAAHGRVDVLVNAAGITRDTTLRKMDPQHWQELMRVNLDGVFNMCRHVVE 125

Query: 173 GMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVRCNAICPG 232
           GM  RG G I+N+SSV +   G   +  Y   KA V G   A+A +   +GV  N + PG
Sbjct: 126 GMSARGFGRIVNLSSV-NGQTGQFGQTNYAAAKAGVHGFGMALARETARKGVTVNTVSPG 184

Query: 233 TIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDESSFTTGQTH 292
              TP L  RV A       +     +  P+GRLG P +IA+ V +LA+D++ + TG   
Sbjct: 185 YCDTP-LVARVPA------EIRAQILEDIPVGRLGSPADIARAVCFLAADDAGYITGANL 237

Query: 293 IIDGGW 298
            ++GG+
Sbjct: 238 PVNGGY 243


Lambda     K      H
   0.320    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 146
Number of extensions: 5
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 300
Length of database: 247
Length adjustment: 25
Effective length of query: 275
Effective length of database: 222
Effective search space:    61050
Effective search space used:    61050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory