Align Glucose/galactose porter (characterized)
to candidate N515DRAFT_1222 N515DRAFT_1222 MFS transporter, FHS family, L-fucose permease
Query= TCDB::P0C105 (412 letters) >FitnessBrowser__Dyella79:N515DRAFT_1222 Length = 422 Score = 237 bits (604), Expect = 6e-67 Identities = 145/399 (36%), Positives = 208/399 (52%), Gaps = 19/399 (4%) Query: 25 LTSLTLLFFMWGFITCLNDILIPHLKNVFQLNYTQSMLIQFCFFGAYFIVSLPAGQLVKR 84 L + LFF+WG LND+LIP K F LN Q+ L+Q F+ YF+V++PAG ++R Sbjct: 16 LALIVSLFFLWGVANNLNDVLIPQFKKAFVLNDFQAGLVQSAFYLGYFLVAMPAGIYMRR 75 Query: 85 ISYKRGIVVGLIVAAIGCALFIPAASYRVYALFLGALFVLASGVTILQVAANPYVTILGK 144 YK +V GL + +G LF PAA Y FL ALFV+ASG+ L+ +ANP+VT+LG Sbjct: 76 FGYKSAVVFGLALYGLGALLFWPAAQQGTYGFFLFALFVIASGLAFLETSANPFVTLLGP 135 Query: 145 PETAASRLTLTQAFNSLGTTVAPVFGAVLILS--------------AATDATVNAEADAV 190 E+AA RL L QAFN LG+ + G I S A A V E AV Sbjct: 136 RESAARRLNLAQAFNPLGSITGILIGQHFIFSGVEHTPEQLAALSAAERAAFVAHETAAV 195 Query: 191 RFPYLLLALAFTVLAIIFAILKPPDVQEDEPALSDKKEGSAWQY---RHLVLGAIGIFVY 247 + PYL + L ++ + + P V E + G+ + R + F Y Sbjct: 196 QLPYLAIGLVVLAWGLLILLTRFPAVHAVEEGAVPRDHGALARLLGDRRFLATLAAQFFY 255 Query: 248 VGAEVSVGSFLVNFLSDPTVAGLSETDAAHHVAYFWGGAMVGRFIGSAAMRYIDDGKALA 307 VGA+V V S+L+ ++ T+ G AA+++ M GRF GSA MRY+ + LA Sbjct: 256 VGAQVGVWSYLIRYV-QATMPGTPAKLAANYMLVSLACFMAGRFAGSALMRYVAPRRLLA 314 Query: 308 FNAFVAIILLFITVATTGHIAMWSVLAIGLFNSIMFPTIFSLALHGLGSHTSQ-GSGILC 366 A V + L VA G +++A F S+M+PTIF+L + G G + GS +L Sbjct: 315 LFAAVNVALTVFAVAVPGVAGACALVACSFFMSVMYPTIFALGVEGRGDDERKLGSALLV 374 Query: 367 LAIVGGAIVPLIQGALADAIGIHLAFLMPIICYAYIAFY 405 + I+GGA++ GA++DA GI A L+P + I + Sbjct: 375 MTIIGGAVLTAAMGAVSDAAGISRAMLVPAASFVVILLF 413 Lambda K H 0.328 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 412 Length of database: 422 Length adjustment: 31 Effective length of query: 381 Effective length of database: 391 Effective search space: 148971 Effective search space used: 148971 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory