Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate N515DRAFT_1702 N515DRAFT_1702 UDP-glucose 4-epimerase
Query= BRENDA::Q9WYX9 (309 letters) >FitnessBrowser__Dyella79:N515DRAFT_1702 Length = 305 Score = 144 bits (364), Expect = 2e-39 Identities = 93/310 (30%), Positives = 161/310 (51%), Gaps = 12/310 (3%) Query: 2 NILVTGGAGFIGSHVVDKLIENGYGVIVVDNLSSGKVENLNRNALFYEQSIEDEEMMERI 61 +IL+ G AGFIG H+ L+++G+ V+V + +L+ AL + ++ + Sbjct: 4 SILILGAAGFIGRHLTQALLDSGHRVMVATRRPE-TLAHLSAEAL---NLVTPDDFRAAL 59 Query: 62 FSLHRPEYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIKYGVKKFIFSSTGGAI 121 H V H A+ ++ S +P ++ + N+ +L LLE + + I+ S+GG + Sbjct: 60 AKAHT---VIHTASSSTPGSSSGQPLKELQ-NLTPTLTLLEALHQQPSIRLIYISSGGTL 115 Query: 122 YGENVKVFPTPETEIPHPISPYGIAKYSTEMYLEFFAREYGLKYTVLRYANVYGPRQDPY 181 Y + + T ++ I P S +G K + E ++E + + TV+R +NVYGP Q+ Sbjct: 116 YTNHDRTPATEKSRI-WPRSYHGAGKIAAESFIEAWCSQQAGSATVIRPSNVYGPGQELR 174 Query: 182 GEAGVVAIFTERMLRGEEVHIFGDGEYVRDYVYVDDVVRANLLAME---KGDNEVFNIGT 238 GV+ ++ RGE + I+GDG RDY+Y+DD V L + K E+FN + Sbjct: 175 VGFGVIPNGFAKLKRGEAMEIWGDGSATRDYLYIDDFVELCLRILSEPAKSGFEIFNASS 234 Query: 239 GRGTTVNQLFKLLKEITGYDKEPVYKPPRKGDVRKSILDYTKAKEKLGWEPKVSLEEGLK 298 G GT++NQL + ++ + G + VY PPR D ++D A ++LGW L++GL+ Sbjct: 235 GTGTSLNQLLQQMELVAGTALKRVYHPPRSLDAEHVVIDAMHAAQRLGWAATTPLQKGLE 294 Query: 299 LTVEYFRKTL 308 T + + L Sbjct: 295 QTWNWLKPRL 304 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 305 Length adjustment: 27 Effective length of query: 282 Effective length of database: 278 Effective search space: 78396 Effective search space used: 78396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory