Align galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized)
to candidate N515DRAFT_3232 N515DRAFT_3232 xylose ABC transporter ATP-binding protein
Query= ecocyc::YTFR-MONOMER (500 letters) >FitnessBrowser__Dyella79:N515DRAFT_3232 Length = 513 Score = 323 bits (829), Expect = 7e-93 Identities = 193/501 (38%), Positives = 292/501 (58%), Gaps = 15/501 (2%) Query: 9 ILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVY-HAD-RGTI 66 + G++K F GVKALD +D LR GE + L GENGAGKSTL+K L+GVY H G I Sbjct: 7 LFEMRGIAKSFGGVKALDGIDLRLRAGECLGLCGENGAGKSTLMKVLSGVYPHGSWDGEI 66 Query: 67 WLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKR-FGLLRRKEMEKR 125 +GQ + ++ +++ GI ++QE+ L+P +SVA+N+F+G E R G + M + Sbjct: 67 LWQGQPLRARSVRDSERAGIVIIHQELMLVPQLSVAENIFLGHEITRPGGRMDYDAMYAK 126 Query: 126 ATELMASYGF-SLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQEVELL 184 A L+ G ++V P + QQ+ I +A+ AK+LILDEPT+SL + E E+L Sbjct: 127 ADALLQELGLHDVNVALPAMHYGGGHQQLFEIAKALAKQAKLLILDEPTSSLTSSETEVL 186 Query: 185 FDLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKMMLGR 244 ++ L+ RGV+ I+++H LD+V +V D + V+R+G + + EL L+ +M+GR Sbjct: 187 LGIVEDLKRRGVACIYISHKLDEVERVCDTVCVIRDGRHIATQPMHELDVDTLITLMVGR 246 Query: 245 ELDT------HALQRAGRTLLSDKPVAAFKNYG-KKGTIAPFDLEVRPGEIVGLAGLLGS 297 +L+ HA+ G + + ++ + ++R GEI+G+AGL+G+ Sbjct: 247 KLENLYPRIEHAI---GEVIFEARHATCLDPVNPQRKRVDDVSFQLRRGEILGIAGLVGA 303 Query: 298 GRTETAEVIFGIKPADSGTAL-IKGKPQNLRSPHQASVLGIGFCPEDRKTDGIIAAASVR 356 GRTE IFG S L ++G+P +RSP A G+G PEDRK GI+ V Sbjct: 304 GRTELVSAIFGAYTGKSSVELFLEGRPLKIRSPADAIRAGLGMVPEDRKRHGIVPLLGVG 363 Query: 357 ENIILALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRW 416 +NI LA I R+ + E I + ++T S PI LSGGNQQK +L++ Sbjct: 364 DNITLATLDHYAHAGHIDRQRELVAIEAQIAERRVKTASPALPIARLSGGNQQKAVLAKM 423 Query: 417 LLTRPQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMR 476 LL RP+ LILDEPTRG+DVGA AEI RLI L A G+A++++SSE+ E++G ADRV++M Sbjct: 424 LLARPKVLILDEPTRGVDVGAKAEIYRLIFELAAQGVAIVLVSSEMPEVLGMADRVLVMG 483 Query: 477 DRKQVAEIPLAELSVPAIMNA 497 + + + P L+ ++ A Sbjct: 484 EGRLRGDFPNQGLTQEQVLAA 504 Lambda K H 0.321 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 600 Number of extensions: 39 Number of successful extensions: 10 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 513 Length adjustment: 34 Effective length of query: 466 Effective length of database: 479 Effective search space: 223214 Effective search space used: 223214 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory