Align galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized)
to candidate N515DRAFT_3232 N515DRAFT_3232 xylose ABC transporter ATP-binding protein
Query= ecocyc::YTFR-MONOMER (500 letters) >FitnessBrowser__Dyella79:N515DRAFT_3232 Length = 513 Score = 323 bits (829), Expect = 7e-93 Identities = 193/501 (38%), Positives = 292/501 (58%), Gaps = 15/501 (2%) Query: 9 ILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVY-HAD-RGTI 66 + G++K F GVKALD +D LR GE + L GENGAGKSTL+K L+GVY H G I Sbjct: 7 LFEMRGIAKSFGGVKALDGIDLRLRAGECLGLCGENGAGKSTLMKVLSGVYPHGSWDGEI 66 Query: 67 WLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKR-FGLLRRKEMEKR 125 +GQ + ++ +++ GI ++QE+ L+P +SVA+N+F+G E R G + M + Sbjct: 67 LWQGQPLRARSVRDSERAGIVIIHQELMLVPQLSVAENIFLGHEITRPGGRMDYDAMYAK 126 Query: 126 ATELMASYGF-SLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQEVELL 184 A L+ G ++V P + QQ+ I +A+ AK+LILDEPT+SL + E E+L Sbjct: 127 ADALLQELGLHDVNVALPAMHYGGGHQQLFEIAKALAKQAKLLILDEPTSSLTSSETEVL 186 Query: 185 FDLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKMMLGR 244 ++ L+ RGV+ I+++H LD+V +V D + V+R+G + + EL L+ +M+GR Sbjct: 187 LGIVEDLKRRGVACIYISHKLDEVERVCDTVCVIRDGRHIATQPMHELDVDTLITLMVGR 246 Query: 245 ELDT------HALQRAGRTLLSDKPVAAFKNYG-KKGTIAPFDLEVRPGEIVGLAGLLGS 297 +L+ HA+ G + + ++ + ++R GEI+G+AGL+G+ Sbjct: 247 KLENLYPRIEHAI---GEVIFEARHATCLDPVNPQRKRVDDVSFQLRRGEILGIAGLVGA 303 Query: 298 GRTETAEVIFGIKPADSGTAL-IKGKPQNLRSPHQASVLGIGFCPEDRKTDGIIAAASVR 356 GRTE IFG S L ++G+P +RSP A G+G PEDRK GI+ V Sbjct: 304 GRTELVSAIFGAYTGKSSVELFLEGRPLKIRSPADAIRAGLGMVPEDRKRHGIVPLLGVG 363 Query: 357 ENIILALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRW 416 +NI LA I R+ + E I + ++T S PI LSGGNQQK +L++ Sbjct: 364 DNITLATLDHYAHAGHIDRQRELVAIEAQIAERRVKTASPALPIARLSGGNQQKAVLAKM 423 Query: 417 LLTRPQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMR 476 LL RP+ LILDEPTRG+DVGA AEI RLI L A G+A++++SSE+ E++G ADRV++M Sbjct: 424 LLARPKVLILDEPTRGVDVGAKAEIYRLIFELAAQGVAIVLVSSEMPEVLGMADRVLVMG 483 Query: 477 DRKQVAEIPLAELSVPAIMNA 497 + + + P L+ ++ A Sbjct: 484 EGRLRGDFPNQGLTQEQVLAA 504 Lambda K H 0.321 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 600 Number of extensions: 39 Number of successful extensions: 10 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 513 Length adjustment: 34 Effective length of query: 466 Effective length of database: 479 Effective search space: 223214 Effective search space used: 223214 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory