Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate N515DRAFT_4212 N515DRAFT_4212 multiple sugar transport system ATP-binding protein
Query= reanno::Smeli:SM_b21216 (360 letters) >FitnessBrowser__Dyella79:N515DRAFT_4212 Length = 364 Score = 322 bits (826), Expect = 8e-93 Identities = 180/356 (50%), Positives = 233/356 (65%), Gaps = 7/356 (1%) Query: 1 MSALEIRNIRKRY--GEVETLKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGG 58 M+ + + +RK Y G V + + GE LVL+G SGCGK+TLL +IAGL SGG Sbjct: 1 MAKVRLDKLRKVYPNGHVGVAEA-SFEIADGELLVLVGPSGCGKTTLLRMIAGLESISGG 59 Query: 59 DILIGERSVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTA 118 + IGER V + PKDRDIAMVFQ+YALYP+++VA N+GFGL++R P+AE ++ V + A Sbjct: 60 TLSIGERVVNDIAPKDRDIAMVFQNYALYPHMTVAENLGFGLKLRGQPKAEIERRVAEAA 119 Query: 119 RLLQIENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKR 178 R+L++E LD +P+ LSGGQRQRVA+GRALVR+P+VFL DEPLSNLDAKLR+ MR E+ R Sbjct: 120 RMLELEQRLDSRPAALSGGQRQRVALGRALVRDPKVFLLDEPLSNLDAKLRLSMRVEIAR 179 Query: 179 LHQMLRTTVVYVTHDQIEAMTLATRIAVMRDGRIEQLAAPDEVYDRPATLYVAGFVGSPP 238 +HQ L+ T+VYVTHDQIEAMTL RI V+ G I+Q+ P +YD PA L+VAGF+GSP Sbjct: 180 IHQRLKATMVYVTHDQIEAMTLGQRIVVLNGGVIQQIDTPMNLYDTPANLFVAGFLGSPA 239 Query: 239 MNILDAEMTANG---LKIEGCEEVL-PLPAAFNGAAWAGRRVKVGIRPEALRLAAGSEAQ 294 MN+L + +G L + E VL LP AW R + VG+RPE L L A + Sbjct: 240 MNLLRGILYRDGGWKLAMPQGELVLGELPQGAALEAWRDRDIVVGLRPEDLLLCADAAGA 299 Query: 295 RLTASVEVVELTGPELVTTATVGSQRITACLPPRTAVGMGSAHAFTFDGTALHLFD 350 L A +EVVE G E+ G + + +PPR GS F F LH FD Sbjct: 300 ALAAQLEVVEPVGNEVFLNLRHGELALVSRMPPRELPAPGSTLHFGFAPERLHFFD 355 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 364 Length adjustment: 29 Effective length of query: 331 Effective length of database: 335 Effective search space: 110885 Effective search space used: 110885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory