Align N-Acetyl-D-glucosamine ABC transport system, permease component 2 (characterized)
to candidate N515DRAFT_3133 N515DRAFT_3133 carbohydrate ABC transporter membrane protein 2, CUT1 family (TC 3.A.1.1.-)
Query= reanno::Phaeo:GFF2752 (280 letters) >FitnessBrowser__Dyella79:N515DRAFT_3133 Length = 273 Score = 144 bits (364), Expect = 2e-39 Identities = 88/268 (32%), Positives = 143/268 (53%), Gaps = 5/268 (1%) Query: 14 LAHGALITYTLIALFPVFVILVNSF-KTRKAIFRDPLGLPTSDTFSLVGYQTVLKQGDFF 72 L +G LI TL+A+FP+ +L SF + +A P LPT T L Y + ++ Sbjct: 9 LVNGLLIGSTLVAVFPLLWMLSVSFMRPGEASALPPPLLPTHAT--LANYHELFERAGMG 66 Query: 73 LYFQNSMIVTVVSLALVLLFGAMAAFALAEYRFKGNMLLGLYLALGIMIPIRIGTVAILE 132 Y NS+ V+ L L F MA +A A+ RF G L L G++IP ++ + + Sbjct: 67 RYLLNSLGVSSAITLLSLAFNLMAGYAFAKLRFSGRERLFQVLLGGLVIPAQVAMLPLFL 126 Query: 133 LMVDTGLVNTLTALILVYTAQGLPLAVFILSEFMKQVSDDLKNAGRIDGLSEYTIFFRLV 192 L+ GLVN+ A+++ A +F++ ++ + + DDL A RIDG E IF ++V Sbjct: 127 LLKYLGLVNSYAAVVV--PAMATIFGIFLVRQYARGIPDDLMEAARIDGAGELRIFVQIV 184 Query: 193 LPLVRPAMATVAVFNMIPIWNDLWFPLILAPAEETKTLTLGSQVFIGQFVTDWNAVLSAL 252 LPL++P M T+A+F + WND +PLI +E TL + + V D +++ Sbjct: 185 LPLLKPIMVTLAIFTFLTAWNDFMWPLIALTGQEHYTLPIALASLSREHVQDSELMMAGS 244 Query: 253 SMAILPVMVLYVIFSRQLIRGITSGAVK 280 + +LPV+VL++ R ++G+ G+VK Sbjct: 245 VVTVLPVLVLFLALQRYYLQGLLLGSVK 272 Lambda K H 0.330 0.143 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 273 Length adjustment: 25 Effective length of query: 255 Effective length of database: 248 Effective search space: 63240 Effective search space used: 63240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory