Align N-acetylglucosamine transporter nagP (characterized)
to candidate N515DRAFT_1918 N515DRAFT_1918 MFS transporter, FHS family, L-fucose permease
Query= reanno::ANA3:7025962 (432 letters) >FitnessBrowser__Dyella79:N515DRAFT_1918 Length = 442 Score = 199 bits (506), Expect = 1e-55 Identities = 139/427 (32%), Positives = 228/427 (53%), Gaps = 29/427 (6%) Query: 13 LPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTFTALPSAWVI 72 + M ++ ++FF+ GF T LN L+P+LK + +LN +A L+ F+F+ A +LP+ ++ Sbjct: 27 MAMGVLTSIFFMWGFLTCLNDILIPHLKAVFKLNYAEAMLVQFTFFGAYFLMSLPAGLLV 86 Query: 73 RKVGYKNGMALGMGIMMLAGLLFIPAAKTQIFGLFLCAQLVMGTGQTLLQTAVNPYVVRL 132 ++GYK G+ G+ + + F PAA + FL A V+ TG T+LQ A N YV L Sbjct: 87 ARLGYKKGIVAGLAVAGVGAAGFWPAAAMHFYPAFLGALFVLATGITVLQVAANAYVALL 146 Query: 133 GPEESAAARVSVMGILNKGAGVIAP-----LVFSALILDSFKDRIGTTLTQVQID---EM 184 GPE+SA++R+++ LN +AP L+ SA +L + ++I Q+ + Sbjct: 147 GPEKSASSRLTLAQALNSLGTFLAPKFGGLLILSAAVLSA--EQIAKLSPAEQVAYRVQE 204 Query: 185 ANSLVFPYLGMAIFIGVLALAVKKSPLPELSNEDEVAEHTDKGQIKAALSHPNLAFGVIA 244 A ++ PYLG+AI + +LA+ V LP L+ + E A + + + L HP++ FGV+A Sbjct: 205 AQTVQGPYLGLAIVLFLLAVFVYLFRLPALTEKTEQAS-VKQHSLVSPLRHPHVLFGVLA 263 Query: 245 LFVYVAVEVIAGDTIGTFALS-LGVEHYGVMTSYTMVCMVLGYTLGIILIPRFISQPTAL 303 +F YV EV IG+F ++ L + G M+ V Y LG +I RFI Sbjct: 264 IFFYVGGEV----AIGSFLVNYLSMPDIGNMSEQAAANWVAYYWLG-AMIGRFIGSALLA 318 Query: 304 MISAILGLLLTLAILFGDNNSYAIANALLVPFGGVALPDTLLFIAFLGLANAIVWPAVWP 363 +S L + AI + A+ ++ G VA + + +GL N+I++P ++ Sbjct: 319 KLSPRKLLAIFAAI------NMALVLTTMMTKGTVA----MYSVVSIGLFNSIMFPTIFS 368 Query: 364 LALSGLGKLTSTGSALLIMGIAGGAFGPLFWGLTSSATDMGQQGGYMVMLPCYLFILFYA 423 L + +G +T S+LLIM I GGA P GL A +G Q + + L CY +I+FY Sbjct: 369 LGIERMGPMTGEASSLLIMAIVGGAIVPFVQGL--FADHIGVQHAFFLPLLCYAYIVFYG 426 Query: 424 VKGHKMR 430 + G +++ Sbjct: 427 LYGSRIK 433 Lambda K H 0.327 0.141 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 442 Length adjustment: 32 Effective length of query: 400 Effective length of database: 410 Effective search space: 164000 Effective search space used: 164000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory