Align DUF1624 domain-containing protein (characterized, see rationale)
to candidate N515DRAFT_4388 N515DRAFT_4388 Predicted acyltransferase
Query= uniprot:L0FVP4 (369 letters) >FitnessBrowser__Dyella79:N515DRAFT_4388 Length = 354 Score = 221 bits (564), Expect = 2e-62 Identities = 144/380 (37%), Positives = 198/380 (52%), Gaps = 44/380 (11%) Query: 5 RILALDVFRGITIFAMILVNNPGSWSHVYAPLLHAKWHGCTPTDLIFPFFLFIVGVAIEL 64 R+ ++D RG + AM+LVN+PG SHVYAPL HA WHGCTPTDLIFPFFLFIVGV+ L Sbjct: 4 RLASVDALRGCMVAAMLLVNDPGDESHVYAPLAHAAWHGCTPTDLIFPFFLFIVGVSTAL 63 Query: 65 SLGGQLKKGTPKGFLLRKSLIRALKLIGLGLLLTAIPYFDLA-----HLRFPGVLQRIGL 119 + +L +G +G LLR +LIRA ++I LGL AI D+ HLR PGVLQRIGL Sbjct: 64 AFEPKLAQGAARGQLLRTALIRAARIIALGL---AIHLLDILVSPDNHLRIPGVLQRIGL 120 Query: 120 VYFISTVMYLYWSPKALVFSSGILLIGYWLCMTFIPVPGIGPANLEPGTNLAAWIDQQVL 179 + +V LY P++ + L IGYW + + LEP N+ D V Sbjct: 121 CFAAVSVFALYTGPRSWWAAIATLAIGYWALL-------LAGGTLEPFANIPDRFDTFVF 173 Query: 180 TGHMWSQ-----TKTWDPEGLFSTLPAIVTCLLGVACGKILTGNSSHKARLTKWGIAGVT 234 GH Q + DPEGL STLP++ TCL+G+ G L + + +A + Sbjct: 174 -GHGTYQFDAATGRGHDPEGLLSTLPSLATCLVGLWAGHTLRAGQTRPLIAVGFALAAL- 231 Query: 235 LVFGGLAWSLFFPLNKALWTSSFVLYTAGWAFLGLAACYWILDVKGWKKWSLPFVIYGMN 294 AWS P NK LWTSSF L+TAG A L L + ++D + W F G+N Sbjct: 232 ----AWAWSYALPFNKNLWTSSFALWTAGLAMLALWLFHTLVDQRNWPPLGRRF---GVN 284 Query: 295 AITVFFLSGVIAKLFGLIKVNWEGTRVSLKLFLQEALFNGW-----LAPKDASLCGAILM 349 A+ + + + L L+ L Q A N W + P+ SL A+ Sbjct: 285 AVAAYAGAETMQTLLPLV----------LTPEAQAAALNAWATAWSIDPRVTSLAYALAF 334 Query: 350 MIILFIPAYFMWKRNIIIKV 369 + + ++ + + KR + IK+ Sbjct: 335 LCLWWLVVHTLDKRKVYIKL 354 Lambda K H 0.329 0.145 0.486 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 478 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 354 Length adjustment: 29 Effective length of query: 340 Effective length of database: 325 Effective search space: 110500 Effective search space used: 110500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory