GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fumD in Dyella japonica UNC79MFTsu3.2

Align fumarate hydratase (EC 4.2.1.2); (S)-2-methylmalate dehydratase (EC 4.2.1.34) (characterized)
to candidate N515DRAFT_4003 N515DRAFT_4003 fumarase, class I, homodimeric

Query= BRENDA::Q141Z6
         (520 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_4003 N515DRAFT_4003
           fumarase, class I, homodimeric
          Length = 504

 Score =  791 bits (2042), Expect = 0.0
 Identities = 390/504 (77%), Positives = 449/504 (89%), Gaps = 3/504 (0%)

Query: 14  MTVIKQEDLIQSIADSLQYISYYHPLDYIQALGRAYELEQSPAAKDAIAQILTNSRMCAE 73
           MT IKQ+DLIQS+AD+LQYISYYHP+DYI  L +AYE E+SPAA+DA+AQIL NSRM AE
Sbjct: 1   MTTIKQDDLIQSVADALQYISYYHPVDYITNLAQAYEREESPAARDAMAQILINSRMAAE 60

Query: 74  GKRPICQDTGIVTVFVKVGMDVRWDGATMGVTDMINEGVRRGYLNPDNVLRASIVSPPEG 133
           G RP+CQDTGIVTVF+KVGM+VRWD AT+ + DM+NEGVRR Y +PDN LRAS+++ P G
Sbjct: 61  GHRPLCQDTGIVTVFLKVGMNVRWD-ATLSLEDMVNEGVRRAYNHPDNKLRASVLADPAG 119

Query: 134 GRKNTKDNTPAVIHYEIVPGNTVDVQVAAKGGGSENKSKFAMLNPSDSIVDWILKTVPTM 193
            R NT+DNTPAVI+  IVPG+TV+V VAAKGGGSE KSKFAMLNPSDSIVDW+LKTVPTM
Sbjct: 120 KRLNTRDNTPAVINVSIVPGDTVEVIVAAKGGGSEAKSKFAMLNPSDSIVDWVLKTVPTM 179

Query: 194 GAGWCPPGMLGIGIGGTAEKAMVMAKESLMDPIDIQDVIARGPKDWIEELRVELHEKVNA 253
           GAGWCPPGMLGIGIGGTAEKAM++AKESLM+ IDIQ++IARGP++ IEELR+EL+EKVNA
Sbjct: 180 GAGWCPPGMLGIGIGGTAEKAMLLAKESLMEHIDIQELIARGPQNRIEELRLELYEKVNA 239

Query: 254 LGIGAQGLGGLATVLDVKIMAAPTHAASKPVAIIPNCAATRHAHFTLDGSGAARLEAPSL 313
           LGIGAQGLGGL TVLDVKI   PTHAA+ PVA+IPNCAATRHAHFTLDGSG   LEAPSL
Sbjct: 240 LGIGAQGLGGLTTVLDVKIKDYPTHAANLPVAMIPNCAATRHAHFTLDGSGPVMLEAPSL 299

Query: 314 DAWPKVHWQPDTEKSKRVDLNTLTPEEVAAWTPGQTLLLSGKMLTGRDAAHKRIADMLAK 373
           + WPK+ +  D+ K +RVDL+T+T E+VA+W PG+ LLL+GK+LTGRDAAHKR+ DML K
Sbjct: 300 EHWPKLTY--DSSKGRRVDLDTITREDVASWKPGEVLLLNGKLLTGRDAAHKRMVDMLNK 357

Query: 374 GEKLPVDFTNRVIYYVGPVDPVRDEAVGPAGPTTATRMDKFTEMMLAQTGLISMIGKAER 433
           GE LPVDF  R IYYVGPVDPVRDE VGPAGPTTATRMDKFTE +LAQTGL+ M+GKAER
Sbjct: 358 GEPLPVDFKGRFIYYVGPVDPVRDEVVGPAGPTTATRMDKFTEQVLAQTGLLGMVGKAER 417

Query: 434 GPVAIEAIRKHKAAYLMAVGGAAYLVSKAIRSAKVLAFEDLGMEAIYEFDVQDMPVTVAV 493
           GP AIEAI++H++ YLMAVGGAAYLVSKAI+S++V+ F DLGMEAIYEFDV+DMPVTVAV
Sbjct: 418 GPAAIEAIKQHQSVYLMAVGGAAYLVSKAIKSSRVVGFADLGMEAIYEFDVKDMPVTVAV 477

Query: 494 DSNGTSVHQTGPKEWQARIGKIPV 517
           DS GTSVHQTGPKEWQARIGKIPV
Sbjct: 478 DSAGTSVHQTGPKEWQARIGKIPV 501


Lambda     K      H
   0.316    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 896
Number of extensions: 27
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 520
Length of database: 504
Length adjustment: 35
Effective length of query: 485
Effective length of database: 469
Effective search space:   227465
Effective search space used:   227465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory