Align GluA aka CGL1950, component of Glutamate porter (characterized)
to candidate N515DRAFT_2392 N515DRAFT_2392 putative ABC transport system ATP-binding protein
Query= TCDB::P48243 (242 letters) >FitnessBrowser__Dyella79:N515DRAFT_2392 Length = 254 Score = 141 bits (356), Expect = 1e-38 Identities = 83/205 (40%), Positives = 121/205 (59%), Gaps = 3/205 (1%) Query: 15 HALTDIDLEIPRGQVVVVLGPSGSGKSTLCRTINRLETIEEGTIEIDGK-VLPEEGKGLA 73 HAL+D+ L I RG+ V + GPSG GK+TL + L+T G+ ++G V A Sbjct: 25 HALSDVHLSIARGEYVSISGPSGCGKTTLLSILGLLDTATSGSFVLNGHDVATLNAAQRA 84 Query: 74 NLR-ADVGMVFQSFNLFPHLTIKDNVTLAPIKVRKMKKSEAEKLAMSLLERVGIANQADK 132 +R A++G +FQ+FNL L++++NV L + +E LERVG+A++ Sbjct: 85 RIRNAEIGFIFQAFNLIGDLSVQENVELPLTYRSSIGAAERRARVQEALERVGMAHRMRH 144 Query: 133 YPAQLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMVNEVLDVMASLAKEGMTMVCV 192 YPAQLSGGQQQRVA+ARAL P I+L DEPT LD V+ ++ L K G T+ V Sbjct: 145 YPAQLSGGQQQRVAVARALVGRPAILLADEPTGNLDSRNGEAVMSLLDELHKGGATICMV 204 Query: 193 THEMGFARKAADRVLFMADGLIVED 217 TH+ +A + A R + + DG +V++ Sbjct: 205 THDARYA-ELAQRKVRLFDGRVVDE 228 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 254 Length adjustment: 24 Effective length of query: 218 Effective length of database: 230 Effective search space: 50140 Effective search space used: 50140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory