Align proton/sodium-glutamate symport protein GltT (characterized)
to candidate N515DRAFT_0013 N515DRAFT_0013 aerobic C4-dicarboxylate transport protein
Query= CharProtDB::CH_088342 (421 letters) >FitnessBrowser__Dyella79:N515DRAFT_0013 Length = 433 Score = 322 bits (825), Expect = 1e-92 Identities = 154/394 (39%), Positives = 254/394 (64%), Gaps = 9/394 (2%) Query: 15 ILGIIV--GAIFYGNPKVAAYLQPIGDIFLRLIKMIVIPIVISSLVVGVASVGDLKKLGK 72 +L IV G I + P+ L+P+GD F+ L+KM++ PI+ ++V+G+A V D+KK+G+ Sbjct: 12 VLAAIVAGGLIGHYAPETGVALKPLGDGFIALVKMLIGPIIFLTVVLGIAGVSDVKKVGR 71 Query: 73 LGGKTIIYFEIITTIAIVVGLLAANIFQPGAGVNMK--SLEKTDIQSYVDTTNEVQHHSM 130 +G K I+YFE++++ A+V+GL+ N +PGAG N SL+ T + Y + +E Sbjct: 72 VGAKAILYFEVVSSFALVIGLVVVNTLKPGAGFNATPASLDATAVAKYANAAHE---QGT 128 Query: 131 VETFVNIVPKNIFESLS-TGDMLPIIFFSVMFGLGVAAIGEKGKPVLQFFQGTAEAMFYV 189 V ++++PK ++ S GD+L ++ +++FG + +GE+ +PV+ F + ++ F + Sbjct: 129 VPFLLHLIPKTFSDAFSGDGDLLQVLLLALLFGFAMIHLGERARPVMTFLEALSKVFFRI 188 Query: 190 TNQIMKFAPFGVFALIGVTVSKFGVESLIPLSKLVIVVYATMLFFIFAVLGGVAKLFGIN 249 IM+ AP G + T+ K+GV SL PL KL+ Y + F+ VLG +A+ G + Sbjct: 189 MGMIMRLAPLGAMGAMAFTIGKYGVHSLGPLLKLMGSFYLACILFVVVVLGAIARATGFS 248 Query: 250 IFHIIKILKDELILAYSTASSETVLPRIMDKMEKFGCPKAITSFVIPTGYSFNLDGSTLY 309 IF ++ +++EL+L T+SSE+ L +M K+E+ GC K++ V+P+GYSFNLDG+ +Y Sbjct: 249 IFKFLRYIREELLLVLGTSSSESALVPLMQKLERLGCSKSVVGLVVPSGYSFNLDGTNIY 308 Query: 310 QALAAIFIAQLYGIDMSVSQQISLLLVLMVTSKGIAGVPGVSFVVLLATLGTV-GIPVEG 368 +AAIF+AQ G+++++SQ+++LL V M+TSKG +GV G F+ L ATL V +PV G Sbjct: 309 LTMAAIFVAQALGVELTLSQELTLLAVAMLTSKGASGVTGAGFITLAATLAVVPSVPVAG 368 Query: 369 LAFIAGIDRILDMARTAVNVIGNSLAAIIMSKWE 402 L+ I GIDR + AR N+IGN +A +++S WE Sbjct: 369 LSLILGIDRFMSEARAITNIIGNGVATVVVSHWE 402 Lambda K H 0.326 0.143 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 433 Length adjustment: 32 Effective length of query: 389 Effective length of database: 401 Effective search space: 155989 Effective search space used: 155989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory