Align (S)-citramalyl-CoA lyase (EC 4.1.3.25) (characterized)
to candidate N515DRAFT_2434 N515DRAFT_2434 (S)-citramalyl-CoA lyase
Query= BRENDA::Q9I562 (275 letters) >FitnessBrowser__Dyella79:N515DRAFT_2434 Length = 321 Score = 117 bits (292), Expect = 4e-31 Identities = 95/270 (35%), Positives = 137/270 (50%), Gaps = 12/270 (4%) Query: 7 RSALFVPATRPERIPKALASGADRVIVDLEDAVEEGLKVEARANLRRFLVDTP--EARVL 64 RS LF PA ER A A+ AD ++DLED+V K EAR F P R Sbjct: 35 RSILFTPALVAERSVNADAADADIALIDLEDSVAAVHKAEARNRAVAFFSRPPITSCRRA 94 Query: 65 VRIN-AAEHPGHADDLALCRDHAGVIGLLLPKVESAAQVRHAA--VASGKPVWPIVESAR 121 VRIN G D LALC +++PKVES + A + G + I+E+ Sbjct: 95 VRINNLGSADGLLDLLALCGCPYKPEVVMVPKVESPRDLEIAGSLLGDGVELIAIIETPL 154 Query: 122 GLAALGE-IAAAAGVERLSFGSLDLALDLDLNSGSNAAEQILGHARYALLLQTRLAGLAP 180 G+ + ++ A + FG+ D AL +G + Q +AR L TR AGL P Sbjct: 155 GIENISATVSTRARLTATIFGAADFAL----TTGMSIDWQSQHYARSRLATATRGAGLHP 210 Query: 181 PLDGVYPAIQNRAGLVEAVRFARDMGFGGLLCIHPSQVEPIHQTLMPSPAELEWARRVAE 240 LD + +++ GL A R AR++G+ G+ +HP QV I++ PS +++ ARR+ Sbjct: 211 -LDSPWFDVRDAEGLTIAARRARELGYSGMGAVHPCQVPIINEIFSPSQDDIDRARRLVA 269 Query: 241 AGA-SGAGVFVVDGEMVDAPVLGRARRLLE 269 A A G+G+ ++DG V AP + ARRLL+ Sbjct: 270 ASARDGSGICLIDGIAVGAPFIESARRLLQ 299 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 321 Length adjustment: 26 Effective length of query: 249 Effective length of database: 295 Effective search space: 73455 Effective search space used: 73455 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory