Align NAD-dependent glycerol dehydrogenase; Dha-forming NAD-dependent glycerol dehydrogenase; EC 1.1.1.6 (characterized)
to candidate N515DRAFT_2399 N515DRAFT_2399 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
Query= SwissProt::Q92EU6 (254 letters) >FitnessBrowser__Dyella79:N515DRAFT_2399 Length = 248 Score = 114 bits (285), Expect = 2e-30 Identities = 78/246 (31%), Positives = 120/246 (48%), Gaps = 7/246 (2%) Query: 12 ITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLDIKEDVKDVAAQINPSRTLALQVDITK 71 + +KVA +TG SGIG A+LF +GA VV++ + A + L + D+ K Sbjct: 3 LKNKVAFITGGTSGIGLETAKLFRAEGAQVVIVGSNAERLAEAGKELGGEVLLVSADLRK 62 Query: 72 KENIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNLKGSFLMAQIIG 131 E+IE V + + + +IDI+ +AG + + E + Y ++ + LN G ++ I Sbjct: 63 VEDIEHAVEQARAAFGRIDIVFANAGASTVAPLEAITPAYVEENVALNFAG--VLFTIQK 120 Query: 132 REMIATGGGKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAPYNINVNAISPT 191 + GG I+ S + + A+KAA S+ + L E AP I VNA+SP Sbjct: 121 TAPLVPKGGSIIVTTSFLNTVGKPGLSVLAATKAAARSLVRTLGAELAPRGIRVNAVSPG 180 Query: 192 VILTELGKK-----AWAGQVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASLITGENLI 246 I T K A +V + + + RFG P EVA LFL S+ +S TG L+ Sbjct: 181 TIATPFYSKIGLTDAQLTEVAAALTEQVGLKRFGDPAEVAKAVLFLASNDSSYTTGVELV 240 Query: 247 IDGGYT 252 +DGG T Sbjct: 241 VDGGLT 246 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 248 Length adjustment: 24 Effective length of query: 230 Effective length of database: 224 Effective search space: 51520 Effective search space used: 51520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory