Align ABC transporter related (characterized, see rationale)
to candidate N515DRAFT_1085 N515DRAFT_1085 D-methionine transport system ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__Dyella79:N515DRAFT_1085 Length = 336 Score = 163 bits (412), Expect = 5e-45 Identities = 101/249 (40%), Positives = 144/249 (57%), Gaps = 17/249 (6%) Query: 13 NIHKSFG----DHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSLA 68 ++HKS+ D L+ SLD G+V I+G SG+GKST +R +NLLE P GS+ + Sbjct: 6 DVHKSYRVDGKDIPALQPFSLDIADGEVFGIIGHSGAGKSTLIRLINLLERPSGGSILID 65 Query: 69 GEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRSR 128 G E M GD L+ RR +GM+FQ+FNL S TV +N I P+R+ + Sbjct: 66 GTE--MTALGDAALRAQRRR--------IGMIFQHFNLLSSQTVADN-IAFPLRLAGETD 114 Query: 129 AESVE-EAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDP 187 A ++ + LL +VGL YPA LSGGQ+QRV IARALA P ++L DE TSALDP Sbjct: 115 AGKIKARVDELLRRVGLEAHASKYPAQLSGGQKQRVGIARALANRPSILLCDEATSALDP 174 Query: 188 ELVGEVLRVMRSLAEEGR-TMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVECK 246 + VL ++ + E + T++++THEM R V +RV L G++ G +VF+ + Sbjct: 175 QTTASVLELLAEINRELKLTIVLITHEMDVVRRVCDRVAVLDAGRIVEHGAVADVFLHPR 234 Query: 247 SDRFRQFVS 255 R+FV+ Sbjct: 235 HPTTRRFVN 243 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 336 Length adjustment: 26 Effective length of query: 237 Effective length of database: 310 Effective search space: 73470 Effective search space used: 73470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory