Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate N515DRAFT_2216 N515DRAFT_2216 cell division transport system ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__Dyella79:N515DRAFT_2216 Length = 225 Score = 160 bits (404), Expect = 4e-44 Identities = 88/221 (39%), Positives = 137/221 (61%), Gaps = 5/221 (2%) Query: 1 MIEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGG 60 MI F V K Y G E AL + G++ + GHSGAGKSTLL+L+ +E PS G Sbjct: 1 MIRFDQVSKRYE-GGHE--ALSQLSFQVAPGEMAFVTGHSGAGKSTLLKLLGLIERPSHG 57 Query: 61 RILVEGEDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDA 120 I ++G+ + + G+ + R+R+GM+FQ LL +TV N+ +PL + GG + AE Sbjct: 58 SISLDGQSLAKIGRGGIPKLRRRIGMVFQDHRLLMDRTVFANVELPL-VIGGVAPAERGR 116 Query: 121 RVSELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASV 180 RV L +VGL + R+ PA LS G++QRVGIARA+ +P++L+ DE T LDPQ + Sbjct: 117 RVRAALEKVGLLAYERQLPATLSTGEQQRVGIARAIVAKPTLLIADEPTGNLDPQLAVEI 176 Query: 181 LQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIV 221 + L AE +++ T+++ +H++ +I+R+ +V V+D G +V Sbjct: 177 MGLFAEF-QQVGTTVLVASHDLPLIKRMRKRVVVLDHGRLV 216 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 225 Length adjustment: 25 Effective length of query: 310 Effective length of database: 200 Effective search space: 62000 Effective search space used: 62000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory