Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate N515DRAFT_3725 N515DRAFT_3725 N-formylglutamate deformylase
Query= reanno::BFirm:BPHYT_RS07585 (271 letters) >FitnessBrowser__Dyella79:N515DRAFT_3725 Length = 266 Score = 284 bits (726), Expect = 2e-81 Identities = 141/253 (55%), Positives = 180/253 (71%), Gaps = 3/253 (1%) Query: 10 FSLHRGSLPLLISIPHLGTQIPADIAATMTPAAQRTDDCDWHLDRLYA-FAKRMGASILA 68 ++LH+GS PLLIS+PH G+ IP IAA + P+A+R D DWH+ RLY A+ +GAS++ Sbjct: 11 YTLHQGSAPLLISLPHDGSFIPESIAARLHPSARRAPDTDWHVGRLYQPLAQALGASVIR 70 Query: 69 PTYARYVIDLNRPPDGANLYPGQDTTGLLPVDTFDKEPLYLDGQLPDEAETTRRRDAYWK 128 P +RYV+DLNRP DG LYPGQ TGL+ FD PLYLDGQ PD AE +R + YW+ Sbjct: 71 PRLSRYVVDLNRPADGHALYPGQRETGLVSTIGFDGVPLYLDGQAPDAAEVQQRVNDYWR 130 Query: 129 PYHEALQGELAALKAKHGKVLLWEAHSIRSHVPRFFEGRLPDFNFGTSNGASAVAGLAEE 188 PYH+AL E+A L HG+V++WE HSIRS VP FEGRLPD N GT++GAS L E Sbjct: 131 PYHQALAQEIARLLDTHGRVVVWEGHSIRSLVPMLFEGRLPDLNLGTADGASCAPALQER 190 Query: 189 MAATVEQYDGGYTAVANGRFKGGYITREYGQPSQGVHALQLELSQITYMEEHMPYAYDET 248 +AA +E Y V NGRFKGGYITR+Y QP QGV +QLEL+Q+ YM+E +AYDE Sbjct: 191 LAARLEA-QSDYAFVVNGRFKGGYITRQYAQPEQGVQTVQLELAQLNYMDED-SFAYDEA 248 Query: 249 LAAKVEPLLEALV 261 AA+++PL+ AL+ Sbjct: 249 KAARLQPLILALL 261 Lambda K H 0.317 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 266 Length adjustment: 25 Effective length of query: 246 Effective length of database: 241 Effective search space: 59286 Effective search space used: 59286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate N515DRAFT_3725 N515DRAFT_3725 (N-formylglutamate deformylase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.11677.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-102 327.9 0.0 2.6e-102 327.8 0.0 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_3725 N515DRAFT_3725 N-formylglutamate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_3725 N515DRAFT_3725 N-formylglutamate deformylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 327.8 0.0 2.6e-102 2.6e-102 2 258 .. 10 265 .. 9 266 .] 0.98 Alignments for each domain: == domain 1 score: 327.8 bits; conditional E-value: 2.6e-102 TIGR02017 2 alevqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklyd.fardlGatvvraaisr 66 ++++++G+aPllislPh G +++++++rl +a+ dtdWh+ +ly+ a+ lGa+v+r ++sr lcl|FitnessBrowser__Dyella79:N515DRAFT_3725 10 TYTLHQGSAPLLISLPHDGSFIPESIAARLHPSARRAPDTDWHVGRLYQpLAQALGASVIRPRLSR 75 6899********************************************846899************ PP TIGR02017 67 lvidvnrdpsgaslypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeie 132 +v+d+nr+ +g++lypgq tgl+ + fdg ply dG+aP++ae+++r++ y++Pyh+al++ei+ lcl|FitnessBrowser__Dyella79:N515DRAFT_3725 76 YVVDLNRPADGHALYPGQRETGLVSTIGFDGVPLYLDGQAPDAAEVQQRVNDYWRPYHQALAQEIA 141 ****************************************************************** PP TIGR02017 133 rlralhgkivlydahsirsviPrlfeGklPdfnlGtndgkscdpaladaveavcakakglssvlnG 198 rl + hg++v+++ hsirs +P lfeG+lPd+nlGt dg+sc+pal+++++a ++ ++ ++ v+nG lcl|FitnessBrowser__Dyella79:N515DRAFT_3725 142 RLLDTHGRVVVWEGHSIRSLVPMLFEGRLPDLNLGTADGASCAPALQERLAARLEAQSDYAFVVNG 207 ****************************************************************** PP TIGR02017 199 rfkGGyitrhygqPqngvhavqlelaqrgyleeetePvaydeakaealravlkelleall 258 rfkGGyitr+y+qP++gv +vqlelaq +y++e+ +aydeaka+ l+ ++ ll+ ++ lcl|FitnessBrowser__Dyella79:N515DRAFT_3725 208 RFKGGYITRQYAQPEQGVQTVQLELAQLNYMDED--SFAYDEAKAARLQPLILALLRECV 265 *******************************965..69************9999999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (266 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.81 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory