Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate N515DRAFT_4327 N515DRAFT_4327 phospholipid/cholesterol/gamma-HCH transport system ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__Dyella79:N515DRAFT_4327 Length = 270 Score = 120 bits (300), Expect = 4e-32 Identities = 75/204 (36%), Positives = 114/204 (55%), Gaps = 11/204 (5%) Query: 51 LSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRRH 110 L L + GEI ++G SG+GKS L+R L PTSG + V G+D+L+L + R Sbjct: 33 LDLDVRRGEILGVVGGSGTGKSVLLRTIVGLRRPTSGQVQVFGQDLLRLPPEQRSRIER- 91 Query: 111 KISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLK------GYENK 164 + ++FQ+ L ++V++N+A L K+ AE + TV L G E+K Sbjct: 92 RFGVLFQNGALFSSQNVVENIAMPLIEHAGLKRPEAEA----LGTVKLALAGLPPGTEHK 147 Query: 165 YPHQLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVF 224 YP +LSGGM +R LARALA D +++ +DE + LDP+ A +L L+ L T+ Sbjct: 148 YPSELSGGMVKRAALARALALDPEVLFLDEPTAGLDPISAAAFDQLILTLRDALGLTVFL 207 Query: 225 ITHDLDEAVRIGNRIAILKDGKLI 248 +THDLD I +R+A+L K++ Sbjct: 208 VTHDLDTLYTICDRVAVLSQKKVL 231 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 270 Length adjustment: 25 Effective length of query: 251 Effective length of database: 245 Effective search space: 61495 Effective search space used: 61495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory