GapMind for catabolism of small carbon sources

 

Aligments for a candidate for permease in Dyella japonica UNC79MFTsu3.2

Align histidine permease (characterized)
to candidate N515DRAFT_2630 N515DRAFT_2630 amino acid/polyamine/organocation transporter, APC superfamily

Query= reanno::pseudo3_N2E3:AO353_12275
         (468 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_2630 N515DRAFT_2630 amino
           acid/polyamine/organocation transporter, APC superfamily
          Length = 454

 Score =  511 bits (1317), Expect = e-149
 Identities = 241/443 (54%), Positives = 330/443 (74%), Gaps = 1/443 (0%)

Query: 6   NGLKRGLSARHIRFMALGSAIGTGLFYGSASAIQMAGPAVLLAYLIGGAAVFMVMRALGE 65
           + L+RGL  RHIR MALGSAIG GLF GSA+AI++AGPA+LL+YL+GG A+F++MRALGE
Sbjct: 5   DSLQRGLQERHIRLMALGSAIGVGLFLGSANAIRLAGPAILLSYLLGGVAIFIIMRALGE 64

Query: 66  MAVHNPVAGSFGQYASTYLGPMAGFILGWTYAFEMVIVGMADVTAFGIYMGFWFPEVSRW 125
           MAV NPVAGSF +YA  YLGP+ G++ GW Y F  ++  +A++TA G+YMG WFP+V +W
Sbjct: 65  MAVQNPVAGSFSRYAQDYLGPLPGYLTGWNYWFMWLMTCIAEITAVGVYMGVWFPDVPQW 124

Query: 126 IWVLGVVSIVGGLNLCNVKVFGEMEFWLSLLKVAAIVAMILGGFGIMLFGISTAPGQVTD 185
           IW L  +  +G +NL  VK +GE EFW +++KV  IV MI+GG  +++FG+    G  T 
Sbjct: 125 IWALAALVTMGAVNLAAVKAYGEFEFWFAMIKVVTIVLMIVGGGAMIVFGLGNQ-GVPTG 183

Query: 186 ISNLWTQGGFMPNGMGGLIASFAVVMFAFGGIEIIGVTAGEAKDPQHVLPRAINAVPLRI 245
           ISNLWT GGFMPNG  G++ +  +VMFA+ G+E+IG+TAGEA +P+  +P AIN+V  RI
Sbjct: 184 ISNLWTHGGFMPNGAKGMLMALQMVMFAYLGVEMIGLTAGEADNPKKSIPDAINSVFWRI 243

Query: 246 LLFYVLTMLVLMSIFPWQQIGSQGSPFVQIFDKLGISSAATILNIVVITAAISAINSDIF 305
           L+FYV  + V+MSI+PW ++G+ GSPFV  F++LGI SAA I+N VV+TAA+S+ N  I+
Sbjct: 244 LIFYVGALFVIMSIYPWNELGTHGSPFVMTFERLGIKSAAGIINFVVLTAALSSCNGGIY 303

Query: 306 GAGRMMFGLAQQGHAPKGFAHLSRNGVPWMTVVVMSVALLLGVLLNYLIPENVFLLIASI 365
             GRM+F LAQQG AP+ FA  S +G+P   V+V  VALL GVLLNYL+P  VF+ + S 
Sbjct: 304 STGRMLFNLAQQGQAPRTFAVTSPSGIPNRAVLVSLVALLFGVLLNYLVPAKVFVWVTSA 363

Query: 366 ATFATVWVWLMILFTQVAMRRSMTAEQVAQLKFPVPFWPYAPMAAIAFMLFVFGVLGYFP 425
           ATF  +W W ++L TQ+  RR ++  Q +QL F +PF+PYA   A+AF++ V G++GYFP
Sbjct: 364 ATFGAIWTWGIVLITQMKYRRGLSEAQRSQLVFRMPFFPYASYLALAFLVLVVGLMGYFP 423

Query: 426 DTQAALIVGVVWIVLLVLAYLMW 448
           DT+ ALIVG +W+VLL + Y ++
Sbjct: 424 DTRVALIVGPLWLVLLTVLYYVF 446


Lambda     K      H
   0.329    0.142    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 737
Number of extensions: 38
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 468
Length of database: 454
Length adjustment: 33
Effective length of query: 435
Effective length of database: 421
Effective search space:   183135
Effective search space used:   183135
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory