Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate N515DRAFT_2156 N515DRAFT_2156 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
Query= reanno::Smeli:SMc03203 (426 letters) >FitnessBrowser__Dyella79:N515DRAFT_2156 Length = 562 Score = 246 bits (627), Expect = 2e-69 Identities = 160/431 (37%), Positives = 233/431 (54%), Gaps = 25/431 (5%) Query: 7 KMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVGD 66 ++PD+G G ++E VK GD V +D L + +DKAT+E+P+P G V L +VGD Sbjct: 128 RVPDIG-GHDGVPVIEVLVKVGDTVAKDQSLITLESDKATMEVPAPFGGVVKELKVKVGD 186 Query: 67 TVAVKAPLVRIETAGEAGEAAPDSIP-EALAEQVLDEPVAVSSR--LEAKAPPQPEKPAP 123 ++ A + IE+A A AAP P +A QV ++P + R L AP PA Sbjct: 187 ELSEGAVIALIESADGAPAAAPAPAPAKAEVPQVEEKPAPIGGRGILPGNAPEGDVAPAA 246 Query: 124 KPAPAPREAPDLSAKPLASPAVRLRARESGIDLRQVAGTGPAGRITHEDLDLFISR---- 179 +P R A P ASPA+R ARE G+D+RQ G+G GRI ED+ ++ Sbjct: 247 RPPFDSRIVMPGDA-PYASPAIRAFARELGVDIRQAKGSGRGGRIVREDITSYVKHALAS 305 Query: 180 GAEPL----PAQTGL----------VRKTAVEEVRMIGLRRRIAEKMSLSTSRIPHITYV 225 GA P PA GL + +EE + +++ ++ + + IPH+T Sbjct: 306 GARPSGAAQPAGGGLNLLPWPKVDFAKFGPIEEKPLTRIQKISGANLARNWAMIPHVTQH 365 Query: 226 EEVDMTALEDLRATMNRDRKPEQAKLTILPFLMRALVKTVAEQPGVNATFDDHAGVIHRH 285 E+ D+T LE R + + K K+T L F ++A+V + + P NA+ D+ + Sbjct: 366 EDADITELEAFRKKLGEENK--DLKITPLVFQIKAVVAALKKFPQFNASLDETGEKLILK 423 Query: 286 AAVHIGIATQTPAGLTVPVVRHAEARGIWDCAAELNRLADAARTGTATRDELTGSTITIS 345 H+GIA TP GL VPV+R + +G+ D A EL ++ AR ++++G +IS Sbjct: 424 KYFHVGIAVDTPDGLVVPVIRDCDKKGLLDLAVELGEISKKARDKKLGPNDMSGGCFSIS 483 Query: 346 SLGAIGGIASTPVINHPEVAIVGVNKIAVRPVWDGAQFVPRKIMNLSSSFDHRVIDGWDA 405 SLG IGG A TP++N PEVAI+GV+K +PVW+G +F PR I+ LS S+DHRVIDG A Sbjct: 484 SLGGIGGTAFTPIVNAPEVAILGVSKAQTKPVWNGKEFAPRLILPLSLSYDHRVIDGALA 543 Query: 406 AVFVQRLKTLL 416 A F L L Sbjct: 544 ARFAAFLANQL 554 Score = 64.7 bits (156), Expect = 7e-15 Identities = 50/148 (33%), Positives = 72/148 (48%), Gaps = 26/148 (17%) Query: 7 KMPDVGEGVAEAELVEWHVKPGDPVREDMVLAAVMTDKATVEIPSPVTGKVLWLGAEVGD 66 ++PD+G ++E VKPGD V ++ L + +DKAT+E+P+P G V + +VGD Sbjct: 8 RVPDIGHD--NVPVIEVLVKPGDKVAKEQGLVTLESDKATMEVPAPFAGTVKEVKLKVGD 65 Query: 67 TVAVKAPLVRIETAGEAGEAAPDSIPEALAEQVLDEPVAVSSRLEAKAPPQPEKPAPKPA 126 V+ A + IE A EA +AP P+A A P P AP PA Sbjct: 66 EVSEGAVIAIIE-ADEA--SAPAPAPQA-------------------AAPAPAPAAPAPA 103 Query: 127 PAPREAPDLSAKPLASPAVRLRARESGI 154 PA P +A P +PA RE+ + Sbjct: 104 PAKAAEPTRAAAP--APAAGGGVREARV 129 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 616 Number of extensions: 31 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 426 Length of database: 562 Length adjustment: 34 Effective length of query: 392 Effective length of database: 528 Effective search space: 206976 Effective search space used: 206976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory