Align 3-ketoacyl-CoA thiolase FadI; ACSs; Acetyl-CoA acyltransferase; Acyl-CoA ligase; Beta-ketothiolase; Fatty acid oxidation complex subunit beta; EC 2.3.1.16 (characterized)
to candidate N515DRAFT_3009 N515DRAFT_3009 acetyl-CoA C-acetyltransferase
Query= SwissProt::P76503 (436 letters) >FitnessBrowser__Dyella79:N515DRAFT_3009 Length = 427 Score = 284 bits (726), Expect = 4e-81 Identities = 162/426 (38%), Positives = 242/426 (56%), Gaps = 11/426 (2%) Query: 14 RIAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPAEVIEQLVFGQVVQMPEA 73 R+ ++ G+R PF R TA+ + + V+G L+ R + E + ++ G V++ Sbjct: 7 RVGVIGGIRIPFCRNNTAYADVGNFGMSVKVLGALVERFRLHGEELGEVAMGAVIKHSSE 66 Query: 74 PNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRAGIAGGADSSSVLP 133 N+ARE VL +G+ T + +RAC TS +A + AG I AGIAGG+D++S +P Sbjct: 67 WNLAREAVLSSGLAPTTPGITTARACGTSLDNAIIIANKIAAGQIEAGIAGGSDTTSDVP 126 Query: 134 IGVSKKLARVLVDVNKARTMSQRLKLFSR-LRLRDLMPVPPAVAEYSTGLRMGDTAEQMA 192 I + ++ + L+ +N+A+ ++ F+R L++L P P VAE TG+ MGD E+MA Sbjct: 127 IVLGERFRKRLLAINRAKGWQDKMAAFTRGFSLKELKPSFPGVAEPRTGMSMGDHCERMA 186 Query: 193 KTYGITREQQDALAHRSHQRAAQAWSDGKLKEEVMTAFIPPYKQPLVEDNNIRGNSSLAD 252 K + I RE QD LA SHQ+ A A+ G ++ V+ P++ L D +R +SS+ Sbjct: 187 KEWHIGREAQDRLALESHQKLAAAYEAGFFEDLVV-----PFRG-LKRDGFLRADSSMEK 240 Query: 253 YAKLRPAFDR--KHGTVTAANSTPLTDGAAAVILMTESRAKELGLVPLGYLRSYAFTAID 310 L+PAFD+ HGT+TA NST L+DGAAAV+L ++ A GL Y A+D Sbjct: 241 LGTLKPAFDKISGHGTLTAGNSTGLSDGAAAVLLGSDEWAARRGLKVQAYFLDAEVAAVD 300 Query: 311 V--WQDMLLGPAWSTPLALERAGLTMSDLTLIDMHEAFAAQTLANIQLLGSERFAREALG 368 + +L+ P + P L R GLT+ D ++HEAFAAQ L ++ SE + R LG Sbjct: 301 FVHGEGLLMAPTVAVPRMLARHGLTLQDFDFYEIHEAFAAQVLCTLRAWESETYCRNRLG 360 Query: 369 RAHATGEVDDSKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVTACAAGGLG 428 G +D +K NV G S+A GHPFAATGAR++ L +G G GL++ C AGG+G Sbjct: 361 LEQPLGSIDPAKLNVHGSSLAAGHPFAATGARIVATLAKMLEEKGSGRGLISICTAGGMG 420 Query: 429 AAMVLE 434 +LE Sbjct: 421 VTAILE 426 Lambda K H 0.319 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 427 Length adjustment: 32 Effective length of query: 404 Effective length of database: 395 Effective search space: 159580 Effective search space used: 159580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate N515DRAFT_3009 N515DRAFT_3009 (acetyl-CoA C-acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.13657.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-117 378.4 0.1 2.1e-117 378.2 0.1 1.0 1 lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 N515DRAFT_3009 acetyl-CoA C-acet Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 N515DRAFT_3009 acetyl-CoA C-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 378.2 0.1 2.1e-117 2.1e-117 1 385 [] 10 426 .. 10 426 .. 0.97 Alignments for each domain: == domain 1 score: 378.2 bits; conditional E-value: 2.1e-117 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaal 66 +++++R+p+++ +++++++ + ++++v+ +l+er+ l+ e++ ev++G+v++++++ n+aRea+l lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 10 VIGGIRIPFCRNNTAYADVGNFGMSVKVLGALVERFRLHGEELGEVAMGAVIKHSSEWNLAREAVL 75 789*******88****************************************************** PP TIGR01930 67 aaglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklg 132 ++gl ++p++t r+C+++l+ ++ a+ki+aG++++ +aGG +++S+vpi+l ++ r++ l ++ lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 76 SSGLAPTTPGITTARACGTSLDNAIIIANKIAAGQIEAGIAGGSDTTSDVPIVLGERFRKRLLAIN 141 ****************************************************************99 PP TIGR01930 133 kakledqllkdl..................vktklsmgetAenlakkygisReeqDeyalrShqka 180 +ak + ++ + ++t++smg + e++ak+++i Re qD++al+Shqk lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 142 RAKGWQDKMAAFtrgfslkelkpsfpgvaePRTGMSMGDHCERMAKEWHIGREAQDRLALESHQKL 207 999888777766899***************9*********************************** PP TIGR01930 181 akAieegkfkdeivpvevkgkkkvvskDegirpnttlekLakLkpafke..kkgstvtAgNssqln 244 a+A+e+g+f+d +vp++ +++D +r+++++ekL++Lkpaf++ +g t tAgNs++l+ lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 208 AAAYEAGFFEDLVVPFRG------LKRDGFLRADSSMEKLGTLKPAFDKisGHG-TLTAGNSTGLS 266 ***************655......679*********************977777.7********** PP TIGR01930 245 DGAaalllmseevakelgltplarivsaavagvdp...eemglgpvpAiekaLkkaglsisdidlv 307 DGAaa+ll s+e+a++ gl++ a++ +a+va+vd e ++++p+ A++++L+++gl+++d+d++ lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 267 DGAAAVLLGSDEWAARRGLKVQAYFLDAEVAAVDFvhgEGLLMAPTVAVPRMLARHGLTLQDFDFY 332 **********************************9999**************************** PP TIGR01930 308 EinEAFAaqvlavekelgs................ldlekvNvnGGAiAlGHPlGasGarivltll 357 Ei+EAFAaqvl ++++s +d++k+Nv+G+++A+GHP++a+Gariv+tl+ lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 333 EIHEAFAAQVLCTLRAWESetycrnrlgleqplgsIDPAKLNVHGSSLAAGHPFAATGARIVATLA 398 *********************************8777***************************** PP TIGR01930 358 keLkergkkyGlatlCvggGqGaAvile 385 k+L+e+g +Gl+++C +gG+G+++ile lcl|FitnessBrowser__Dyella79:N515DRAFT_3009 399 KMLEEKGSGRGLISICTAGGMGVTAILE 426 *************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (427 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.82 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory