Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate N515DRAFT_1006 N515DRAFT_1006 3-oxoacyl-[acyl-carrier protein] reductase
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >FitnessBrowser__Dyella79:N515DRAFT_1006 Length = 248 Score = 130 bits (327), Expect = 3e-35 Identities = 89/249 (35%), Positives = 134/249 (53%), Gaps = 6/249 (2%) Query: 18 RLKNKVVLLTGAAQGIGEAIVATFASQQARLVISDIQGEK-VEKVAAHWREQGADVVAIK 76 +LK KV L+TGA++GIG I A++ A +V++ + + V + G VA+K Sbjct: 3 KLKGKVALVTGASKGIGAGIAKALAAEGAAVVVNYASSKAGADAVVDAITKAGGKAVAVK 62 Query: 77 ADVSRQQDLHAMARLAIELHGRIDVLVNCAGVNVFRDPLQMTEEDWHRCFAIDLDGAWYG 136 DV++ D A+A A++ GR+D+LVN +GV F Q+TE+ +H+ F +++ G Sbjct: 63 GDVAQAADAQAIADAAVKEFGRLDILVNNSGVYEFAPLEQITEDHFHKQFNVNVLGLLLT 122 Query: 137 CKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGIRVN 196 +A M E GSIINI S + + PG Y K + +T L E P+ IRVN Sbjct: 123 TQAAAKHMGEG--GSIINIGSLVTRIVPPGGSVYTATKGAVDAITGVLSRELGPRKIRVN 180 Query: 197 AIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPFIN 256 A+ PG +ET+ V +D H Q A P RIGQP ++A AVFLASD++ ++ Sbjct: 181 ALNPGMVETEGTVTAGFIGSDFH---QEAIAHTPLGRIGQPQDIATIAVFLASDDSYWLT 237 Query: 257 ASCITIDGG 265 + GG Sbjct: 238 GEKLYAAGG 246 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 248 Length adjustment: 24 Effective length of query: 248 Effective length of database: 224 Effective search space: 55552 Effective search space used: 55552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory