Align lactose 3-dehydrogenase γ subunit (EC 1.1.99.13) (characterized)
to candidate N515DRAFT_1320 N515DRAFT_1320 Gluconate 2-dehydrogenase subunit 3
Query= metacyc::MONOMER-15714 (182 letters) >FitnessBrowser__Dyella79:N515DRAFT_1320 Length = 196 Score = 91.7 bits (226), Expect = 7e-24 Identities = 61/193 (31%), Positives = 95/193 (49%), Gaps = 18/193 (9%) Query: 2 LNRRDALRGLA-LTVGAAAT----GWAGTAAATTALSWTPTALTPEQAQILDVVAELIIP 56 +NRR+ L+ + L VG AA AA P TP Q + V ++I+P Sbjct: 1 MNRREWLKSMTTLAVGVAAAPSLLAVFDAHAAAQKGGPAPQFFTPPQHDTVTAVVDIIVP 60 Query: 57 ATDTPGARAAGVPQFIDRAIANYCEKWQVDQLVGGFARMDADAKAAHGKLFVALAPEQQV 116 TDTPGA AGVP+FID+ + + + + A + + GK F L +Q++ Sbjct: 61 RTDTPGAVDAGVPRFIDQMFKDVYTPEEQKRYLTAMAAFEKEG----GKPFAQLDAKQRL 116 Query: 117 AILNVYDRETAVS-------TSGHFFPLLEDFVTVGYFTSEPGATLALKYDPVPGAYNGC 169 A++ + + ++ F + + T G+F S+PG T ++Y PVPGAY+G Sbjct: 117 ALVTKLHEQALIKGKDLDPESAAAFVLMTKRLATSGFFISQPGCTQVMQYMPVPGAYHGD 176 Query: 170 VPLAEIGRG--WA 180 +PL+E G G WA Sbjct: 177 IPLSEAGNGRAWA 189 Lambda K H 0.320 0.134 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 103 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 182 Length of database: 196 Length adjustment: 20 Effective length of query: 162 Effective length of database: 176 Effective search space: 28512 Effective search space used: 28512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory