Align ABC transporter for Lactose, ATPase component (characterized)
to candidate N515DRAFT_1562 N515DRAFT_1562 sulfate transport system ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >FitnessBrowser__Dyella79:N515DRAFT_1562 Length = 384 Score = 206 bits (523), Expect = 1e-57 Identities = 131/332 (39%), Positives = 184/332 (55%), Gaps = 24/332 (7%) Query: 4 LQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDLTID 63 L + + + YG + LDI GEFV +GPSG GKS+LLR++AGL++ GD+ D Sbjct: 3 LSIRQLTRRYGAFAALDDFSLDIAEGEFVALLGPSGSGKSSLLRILAGLDDPDRGDVLRD 62 Query: 64 DVRMNDVDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRA------EIEKRVNEA 117 + + +R I +VFQ YAL+PHMTV +N+ F LR PRA +I RV + Sbjct: 63 GTDLLALPAQRRDIGLVFQHYALFPHMTVADNIAFGLRVR--PRARRPSRRDIAARVEDL 120 Query: 118 AHILELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEIA 177 ++L L R P QLSGGQRQRVA+ RA+ P + L DEP LDA++R +R+ + Sbjct: 121 LRRVQLEELGRRYPTQLSGGQRQRVALARALAVEPSLLLLDEPFGALDAQVRGTLRVWLR 180 Query: 178 RLHKQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIGSP 237 L + L T V VTHDQ EA+ LAD++VVM G +EQVG+P ++Y +PA FV GF+G Sbjct: 181 DLQRSLGLTTVLVTHDQDEALELADRVVVMNRGRIEQVGAPSEIYREPATPFVHGFVG-- 238 Query: 238 KMNFLKGVIEIDEDQAYARLPDYG---DAKIPVTLQAAAGTAVTIGIRPEHFDEA--GPA 292 + N ++G +E D RL G ++P L AG + +RPEH A G Sbjct: 239 RANRIRGHVERD------RLHLGGHSFQGELPGDL---AGREIEAWLRPEHLALASRGLG 289 Query: 293 ALDLAIDMLEHLGGETFAYARHHGNGELIVVE 324 + L+ G A HG+G ++ E Sbjct: 290 GWTGRLQHLDLAGPVARARLAMHGDGLVLDAE 321 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 384 Length adjustment: 30 Effective length of query: 328 Effective length of database: 354 Effective search space: 116112 Effective search space used: 116112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory