Align ABC transporter for Lactose, ATPase component (characterized)
to candidate N515DRAFT_4212 N515DRAFT_4212 multiple sugar transport system ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >FitnessBrowser__Dyella79:N515DRAFT_4212 Length = 364 Score = 333 bits (855), Expect = 3e-96 Identities = 187/367 (50%), Positives = 245/367 (66%), Gaps = 15/367 (4%) Query: 1 MSELQLSDVRKSYGGLEV-IKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGD 59 M++++L +RK Y V + +I GE +V VGPSGCGK+TLLRMIAGLE IS G Sbjct: 1 MAKVRLDKLRKVYPNGHVGVAEASFEIADGELLVLVGPSGCGKTTLLRMIAGLESISGGT 60 Query: 60 LTIDDVRMNDVDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNEAAH 119 L+I + +ND+ P R IAMVFQ+YALYPHMTV EN+GF L+ G P+AEIE+RV EAA Sbjct: 61 LSIGERVVNDIAPKDRDIAMVFQNYALYPHMTVAENLGFGLKLRGQPKAEIERRVAEAAR 120 Query: 120 ILELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEIARL 179 +LEL LD +P LSGGQRQRVA+GRA+VR PK+FL DEPLSNLDA+LR+ MR+EIAR+ Sbjct: 121 MLELEQRLDSRPAALSGGQRQRVALGRALVRDPKVFLLDEPLSNLDAKLRLSMRVEIARI 180 Query: 180 HKQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIGSPKM 239 H++L T+VYVTHDQ+EAMTL +IVV+ GV++Q+ +P++LYD PANLFVAGF+GSP M Sbjct: 181 HQRLKATMVYVTHDQIEAMTLGQRIVVLNGGVIQQIDTPMNLYDTPANLFVAGFLGSPAM 240 Query: 240 NFLKGVIEIDEDQAYARLPD----YGDAKIPVTLQAAAGTAVTIGIRPEHF---DEAGPA 292 N L+G++ D A +P G+ L+A + +G+RPE +A A Sbjct: 241 NLLRGILYRDGGWKLA-MPQGELVLGELPQGAALEAWRDRDIVVGLRPEDLLLCADAAGA 299 Query: 293 ALDLAIDMLEHLGGETFAYARHHGNGELIVVETKNGRGLKT-GDRLTARFDPVSVLVFD- 350 AL ++++E +G E F RH GEL +V R L G L F P + FD Sbjct: 300 ALAAQLEVVEPVGNEVFLNLRH---GELALVSRMPPRELPAPGSTLHFGFAPERLHFFDA 356 Query: 351 -GEGKRL 356 GEG R+ Sbjct: 357 KGEGARI 363 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 364 Length adjustment: 29 Effective length of query: 329 Effective length of database: 335 Effective search space: 110215 Effective search space used: 110215 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory