GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lacZ in Dyella japonica UNC79MFTsu3.2

Align Exo-alpha-(1->6)-L-arabinopyranosidase; APY; Beta-D-galactopyranosidase; EC 3.2.1.- (characterized)
to candidate N515DRAFT_3019 N515DRAFT_3019 beta-glucosidase

Query= SwissProt::E7CY69
         (757 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_3019 N515DRAFT_3019
           beta-glucosidase
          Length = 737

 Score =  311 bits (796), Expect = 1e-88
 Identities = 226/682 (33%), Positives = 326/682 (47%), Gaps = 65/682 (9%)

Query: 24  GDAWHLQGVESKGIPSYMITDGPHGLRKSLASSAGETDLDDSVPATCFPPAAGLSSSWNP 83
           G A ++  +E  GIP+   +D   G+  S     G+        AT  P     +++W+P
Sbjct: 82  GSAGYIPALERVGIPAIQESDAGLGVASSERMRPGDY-------ATPLPAGPVTAATWDP 134

Query: 84  ELIHKVGEAMAEECIQEKVAVILGPGVNIKRNPLGGRCFEYWSEDPYLAGHEAIGIVEGV 143
           ++  + G  +  E   +   V+L  G N+ R P  GR FEY  EDP LAG      + G+
Sbjct: 135 KVAFRGGAMIGGEAHAKGFNVLLAGGTNLMREPRNGRNFEYAGEDPLLAGTMVGEAIRGI 194

Query: 144 QSKGVGTSLKHFAANNQETDRLRVDARISPRALREIYFPAFEHIVKKAQPWTIMCSYNRI 203
           +S+ V +++KHFA N+QET R  VD RI  +A+RE    AFE  +++ +P ++MCSYN++
Sbjct: 195 ESQHVVSTIKHFALNDQETARTTVDVRIGEQAMRESDLLAFELAIERGKPGSVMCSYNKL 254

Query: 204 NGVHSAQNHWLLTDVLRDEWGFDGIVMSDWGADHDRGASLNAGLNLEMPPSYTDDQIVY- 262
           NG  + +N +LL  VL+ +W + G VMSDWG  H    ++NAGL+ E      D  I + 
Sbjct: 255 NGDWACENDYLLNQVLKRDWKYPGFVMSDWGGVHSAAKAVNAGLDQESAAEIFDKDIYFD 314

Query: 263 -AVRDGLITPAQLDRMAQGMIDLVNKTRAAMSIDNY-----RFDVDAHDEVAHQAAIESI 316
             +RD L            M+  + ++  A  +  +       D  A+  VA +      
Sbjct: 315 KPLRDALAKGEVKQARIDDMVRRILRSFFAAGVFEHPAKKAPIDEKANLAVARETLEAGA 374

Query: 317 VMLKNDDAILPLNAGPVANPSATPQKIAVIGEFARTPRYQGGGSSHITPTKMTSFLDTLA 376
           V+L+ND+ +LPL+        A  + IAVIG  A      GGGSS +T           A
Sbjct: 375 VLLRNDNQLLPLDV-------ARLESIAVIGAHADKGVLAGGGSSLVTAKGGN------A 421

Query: 377 ERGIKADFAPGFTLDLEPADP--ALES----------------EAVETAKNADVVLMFLG 418
             G+K    PG  +   P  P  AL+S                 A   A  + V ++F+ 
Sbjct: 422 VPGLKPSDWPGPVM-YHPYSPLKALQSMAPKAKVQFTGGDDVAAAAALAAKSQVAVVFV- 479

Query: 419 LPEAVESEGFDRDTLDMPAKQIALLEQVAAANQNVVVVLSNGSVITVAPWAKNAKGILES 478
             +    E FD   L +P  Q AL+  VA AN   +VVL NGS + + PW +    +LE 
Sbjct: 480 --QKWAGEDFDARDLSLPDGQDALVTAVAKANPRTIVVLENGSPVAM-PWLEQVGAVLEV 536

Query: 479 WLLGQSGGPALADVIFGQVSPSGKLAQSIPLDINDDPSMLNWPGEEG------HVDYG-E 531
           W  G   G  +A+++ G+V+PSG+L  S P D+   P     PG  G       VDY  E
Sbjct: 537 WYPGGDAGNGIANLLSGKVNPSGRLPLSWPRDVLQLPRP-ELPGAGGSGALPQSVDYAIE 595

Query: 532 GVFAGYRYYDTYGKAVDYPFGYGLSYATFEITGVAVAKTGANTATVTATVTNTSDVDAAE 591
           G   GYR+Y +      +PFGYGLSY +FE  G     T     T T TV NT     A+
Sbjct: 596 GANVGYRWYQSKDLQPLFPFGYGLSYTSFE-HGALKVDTKDGKVTATVTVRNTGKRAGAD 654

Query: 592 TVQVYV-VPGKADVARPKHELKGFTKAFLKAGESKTVAIDLDERAFAYWSEKYNDWHVEA 650
             QVYV VPG          L GF+K FLK GE + ++I L+ +  A +    + W V  
Sbjct: 655 VAQVYVQVPG-----AKARRLAGFSKVFLKPGEQRELSIPLERKLLADFDTARHGWVVRG 709

Query: 651 GEYAIEVGVSSRDIADTVAVAL 672
           GEY +  G SS D+    AV L
Sbjct: 710 GEYVVSEGRSSADLGRPAAVQL 731


Lambda     K      H
   0.315    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1423
Number of extensions: 66
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 757
Length of database: 737
Length adjustment: 40
Effective length of query: 717
Effective length of database: 697
Effective search space:   499749
Effective search space used:   499749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory