GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lacZ in Dyella japonica UNC79MFTsu3.2

Align β-galactosidase (GalD) (EC 3.2.1.23) (characterized)
to candidate N515DRAFT_3226 N515DRAFT_3226 Beta-galactosidase GanA

Query= CAZy::ABA39423.1
         (579 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_3226 N515DRAFT_3226
           Beta-galactosidase GanA
          Length = 532

 Score =  636 bits (1641), Expect = 0.0
 Identities = 310/518 (59%), Positives = 385/518 (74%), Gaps = 5/518 (0%)

Query: 63  AAPATQTPMPQFVSKDGKHALMVDGAPFLILGAQVNNSSNYPGVMDKVWPAMQVLGPNTV 122
           A+PA    MP+ V++ G+HAL+VDG PFLILGAQVNNSSN+P ++D+VWPA+  L  NTV
Sbjct: 18  ASPALAEDMPRLVAEHGRHALLVDGKPFLILGAQVNNSSNWPAMLDEVWPAIGQLHANTV 77

Query: 123 QVPIAWEQVEPEEGKFDFSFVDTLLAQAREHKVRLVLLWFATWKNNGPAYAPHWVKTDNQ 182
           QVPIAWEQ+EP+EG+FDFSF+DTL+ QAREH+VRLVLLWFATWKNNGP+YAP WVK D++
Sbjct: 78  QVPIAWEQIEPKEGQFDFSFLDTLVEQAREHRVRLVLLWFATWKNNGPSYAPSWVKLDDR 137

Query: 183 RFPRVVTREGKAIGSLSPHAQATLDADRKAFVAFMQHLKQVDPQ-HTVIMIQPENEPGTY 241
           RFPR++ REG+ + SLSP A ATL+ADRKAFV  M HL+++D + HTVIM+Q ENE GTY
Sbjct: 138 RFPRLMNREGRRLNSLSPLASATLEADRKAFVQLMTHLRKIDGERHTVIMVQVENESGTY 197

Query: 242 GSVRDFSPMAQKLFDGPVPDELLKRLNKQPGSWAQVFGADADEIFHAWSIGRYIDQVAEA 301
           G+ RD SPMA K+F G VP+ LL+   K  G+W+QVFG DA E FHAW +  +I+QV  A
Sbjct: 198 GTDRDHSPMADKVFAGSVPEALLRATGKPAGNWSQVFGNDAAEFFHAWHVAHFIEQVTAA 257

Query: 302 GKQAYPLPMYVNAALRGPFNPGQPGQYASGGPTDNVLDVWKAAGPHIDLLAPDIYMPEYR 361
           GK  YPLPMY NAALR PFNPG PG Y SGGPTDNVL VWKAA P +D+LAPDIY P+Y+
Sbjct: 258 GKAVYPLPMYANAALRDPFNPGPPGAYESGGPTDNVLHVWKAAAPSLDVLAPDIYKPDYK 317

Query: 362 MYTTVLERYARPDNALFVAETGNRPEYARYLFPTLGHDGVGWSAFGMDYTRYSNYPLGAK 421
            Y+T LERYAR DN LFVAETGN   YARY++  +G   +GWS FGMD+T YSNYPLGA+
Sbjct: 318 HYSTYLERYARKDNPLFVAETGNDKVYARYVYAAVGAGAIGWSPFGMDFTGYSNYPLGAR 377

Query: 422 HVNEETLAPFALGFKLVSLGMRPFAKAASEGKLHGTAEEPGQAVQELKLNDRWSATITYG 481
            V+++TLA FA  +++++      A AA  GKL G AE        L L + W A + +G
Sbjct: 378 KVDDDTLAMFAANYRVLAPMAGELAAAAYAGKLWGAAEPDDTHEATLDLGE-WQAHLGFG 436

Query: 482 VPQFWFKGEPP-GNPEPIGAALIAELGPDEFLVTGYHVRVTLHPASEATANMLYDRVEEG 540
             Q  F  EPP GNP+  G ALIA+L P+E+LV    VRV+  PA     + L DRVEEG
Sbjct: 437 --QLQFGTEPPKGNPDHAGGALIAQLAPNEYLVVARDVRVSFSPAHGRKPDFLLDRVEEG 494

Query: 541 QYDGDTWQFQRNWNGDQTDYGVNFSSAPQLLKIKLATY 578
            YD   W F+R WNGDQTD+G+NF   P++L+++LATY
Sbjct: 495 HYDHGRWVFRRLWNGDQTDWGLNFIGEPRVLRVRLATY 532


Lambda     K      H
   0.317    0.134    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1126
Number of extensions: 52
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 579
Length of database: 532
Length adjustment: 36
Effective length of query: 543
Effective length of database: 496
Effective search space:   269328
Effective search space used:   269328
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory