Align Branched chain amino acid (Leucine/isoleucine/valine) uptake transporter of 469 aas and 12 TMSs, BcaP or CitA (characterized)
to candidate N515DRAFT_0722 N515DRAFT_0722 amino acid/polyamine/organocation transporter, APC superfamily (TC 2.A.3)
Query= TCDB::S6EX81 (469 letters) >FitnessBrowser__Dyella79:N515DRAFT_0722 Length = 479 Score = 274 bits (700), Expect = 5e-78 Identities = 159/459 (34%), Positives = 252/459 (54%), Gaps = 14/459 (3%) Query: 15 ADKHYNQVLTTRDFLALGVGTIISTSIFTLPGQVAAQFAGPGVVFSYLLAALVAGFVALA 74 AD + L ++ + LGVG +I IF + GQ AA+ AGP + S++LA L A AL+ Sbjct: 19 ADDSLRRTLGLKELVVLGVGAVIGAGIFVITGQAAAEHAGPALTLSFVLAGLAAALAALS 78 Query: 75 YAEMSTVMPFAGSAYSWISVLFGEGFGWIAGWALLAEYFIAVAFVGSGFSANLQQLLAPL 134 YAE + ++P +GSAY + FGE W GW ++AEY +AV+ V G+S LL L Sbjct: 79 YAEFAAMLPVSGSAYVYAYATFGELLAWFIGWNVVAEYLLAVSSVAVGWSGYGVGLLKSL 138 Query: 135 GFHLPKVLANP--------FGTDGGVVDIISLLVILLSAIIVFRGASDAGRISQILVVLK 186 G +P LAN G ++++ +LLV+ +++RG + + ++V LK Sbjct: 139 GIEVPAALANAPLSFKDGHLELTGALLNLPALLVVAALTALLYRGTRQSTMFASVVVALK 198 Query: 187 VAAVIAFIIVGITVIKPANYHPFIPPHNPKTGFGGFSGIWSGVSMIFLAYIGFDSIAANS 246 V V+ F++ G+ + P+ +HP++P + + G++G++ + +F AYIGFD++A + Sbjct: 199 VIVVVLFVVCGLQYVDPSLWHPYVPANQGGDHY-GWAGVFRAATSVFYAYIGFDAVATAA 257 Query: 247 AEAKNPQKTMPRGIIGSLLIAVVLFAAVTLVLVGMHPYSAYAGNAAPVGWALQQSGYSVL 306 E +NPQ+ +P GI+ SL I VL+ V VL G+ PY A A PV AL Sbjct: 258 QETRNPQRNVPAGILISLAICTVLYIIVAAVLTGLVPYPQLA-TAEPVATALAAHPPLAW 316 Query: 307 SEVVTAI-ALAGMFIALLGMVLAGSRLLYAFGRDGLLPKGLGKMNARN-LPANGVWTLAI 364 +++T + A+AG+ +L M L SR+LY+ DGLLP G ++ R+ P + Sbjct: 317 LKLLTQVGAVAGLTSVILVMHLGLSRILYSMAGDGLLPTFFGAVHERHRTPHRTTLLVGA 376 Query: 365 VAIVIGAFFPFAFLAQLISAGTLIAFMFVTLGIYSLRRRQGKDLPEATYKMPFYPVLPAL 424 V V+ A FP + L L+S GTL+AF V +G+ LRR +LP +++P P + L Sbjct: 377 VGGVLAAVFPLSLLGDLLSMGTLLAFATVCIGVLVLRRTH-PNLPRG-FRVPAAPAVCTL 434 Query: 425 GFIGSLFVFWGLDVQAKLYSGIWFLIGILIYFAYGNRRS 463 G + F+ +++ + W +G+LIY AYG R S Sbjct: 435 GVLVCAFLLAQMNLGNWILLAAWTTLGMLIYIAYGYRHS 473 Lambda K H 0.328 0.143 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 599 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 479 Length adjustment: 33 Effective length of query: 436 Effective length of database: 446 Effective search space: 194456 Effective search space used: 194456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory