GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bkdB in Dyella japonica UNC79MFTsu3.2

Align 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 (characterized)
to candidate N515DRAFT_0355 N515DRAFT_0355 pyruvate dehydrogenase E1 component beta subunit

Query= SwissProt::Q5SLR3
         (324 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_0355 N515DRAFT_0355 pyruvate
           dehydrogenase E1 component beta subunit
          Length = 326

 Score =  317 bits (812), Expect = 3e-91
 Identities = 162/323 (50%), Positives = 222/323 (68%), Gaps = 1/323 (0%)

Query: 1   MALMTMVQALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLLQKYGPDRVMDTPLSE 60
           MA +T+++A+ +AL  EMA+DP VVVLGEDVG  GGVF  T+GL +K+G  RV+DTPL E
Sbjct: 1   MAQITLIEAVTQALAYEMARDPSVVVLGEDVGVNGGVFRATQGLQEKFGELRVLDTPLDE 60

Query: 61  AAIVGAALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSG 120
             I G  +GMAA G++PVAE QF  +I+P  +Q+    A+LR R+ G+ T P V R P G
Sbjct: 61  TTIAGVTVGMAAQGMKPVAEAQFEGFIYPMMEQIACHAARLRNRTRGRITVPAVWRAPWG 120

Query: 121 GGVRGGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIRDEDPVVFLEPKRLYRSV 180
           GG+R   HHS++ E  F +  GL+VV  S+P  A GLL AAIRD DPV+F EPKR+YR  
Sbjct: 121 GGIRAPEHHSEANEHLFTNIPGLRVVMPSSPARAYGLLLAAIRDPDPVMFFEPKRIYRQY 180

Query: 181 KEEVPEEDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKAGVSAEVLDLRTLM 240
           KEEVP++   LP+    + R+G D+T++ +G  + E L+AA ELA  G+SAEV+D+ TL 
Sbjct: 181 KEEVPDDGEALPLDVCFVLRDGTDVTIVTWGAQVKEALEAADELAAEGISAEVIDVATLT 240

Query: 241 PWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAEDLLDMLLAPPIRVTGFDTPYP 300
           P D++ +  SV KTGR V+V +AP+ A F +E+AA +AE+ L  LLAP  RVTG+DT  P
Sbjct: 241 PLDFDTIAESVQKTGRCVIVHEAPKTAGFGAEIAARVAEECLYELLAPVERVTGYDTHIP 300

Query: 301 -YAQDKLYLPTVTRILNAAKRAL 322
            +  +  Y+P+  R++ AAKR L
Sbjct: 301 LFRLEMKYMPSTERVVEAAKRTL 323


Lambda     K      H
   0.319    0.136    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 294
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 324
Length of database: 326
Length adjustment: 28
Effective length of query: 296
Effective length of database: 298
Effective search space:    88208
Effective search space used:    88208
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory