Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate N515DRAFT_0416 N515DRAFT_0416 3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase
Query= BRENDA::Q1D5Y4 (258 letters) >FitnessBrowser__Dyella79:N515DRAFT_0416 Length = 686 Score = 124 bits (310), Expect = 7e-33 Identities = 78/191 (40%), Positives = 110/191 (57%), Gaps = 4/191 (2%) Query: 6 VDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAGAD 65 +D G + + S NA+SR +L ELG++V R+S + V+I A F GAD Sbjct: 14 LDDSGIVTLTLDRANSSVNALSREVLDELGQIVERLSIEKPA-GVLIHSAKPGGFAVGAD 72 Query: 66 LKERATMAED-EVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAP 124 +KE A D V ++ +R F ++ + C +AAI+GA +GGGTEL LAC R+AA Sbjct: 73 IKEFVEYARDGTVLQNIENGQRVFESLARLPCPTVAAIHGACMGGGTELVLACRQRIAAD 132 Query: 125 --AAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAP 182 +GL EV LGI PG GGT RL RL+G A ++LT + ++A A ++G+ +RLAP Sbjct: 133 DEKTRIGLPEVMLGIHPGWGGTARLPRLIGALDALPVMLTGKALSARRAAALGVVDRLAP 192 Query: 183 EGHLLAVAYGL 193 LLA A L Sbjct: 193 PNELLAEARAL 203 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 686 Length adjustment: 31 Effective length of query: 227 Effective length of database: 655 Effective search space: 148685 Effective search space used: 148685 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory