Align Methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate N515DRAFT_0930 N515DRAFT_0930 methylglutaconyl-CoA hydratase
Query= reanno::pseudo6_N2E2:Pf6N2E2_2193 (272 letters) >FitnessBrowser__Dyella79:N515DRAFT_0930 Length = 264 Score = 199 bits (505), Expect = 7e-56 Identities = 120/264 (45%), Positives = 158/264 (59%), Gaps = 3/264 (1%) Query: 4 FNTLELHSDPRGVATLWLSRESKNNAFNAEMIRELILALDHVSSDPNLRFLLIRGRGKHF 63 + +L+L +D GV T+ ++R +NAF+ +I EL AL D N+R +++ G G F Sbjct: 2 YTSLQL-ADRAGVRTVTMNRPQVHNAFDDSLIAELTDALAAAGRDENVRAVVLTGAGASF 60 Query: 64 SAGADLAWMQQSAELDYHTNLDDARELAELMYNLAKLKIPTLAVVQGAAFGGALGLISAC 123 SAGADL WM+ A+ N +D+ LA LM L L PT+A V GAA+GG +GLI+ C Sbjct: 61 SAGADLNWMRGMAKASEAENREDSLRLAALMRTLQFLPKPTVARVNGAAYGGGVGLIACC 120 Query: 124 DMAIGADEAQFCLSEVRIGLAPAVISPFVVQAIGERAARRYALTAERFDGQRAKEIGLLS 183 D+AIG D A+F L+EV++GL PAVISP+V+ AIG R +RR LT E FD A+ IGLL Sbjct: 121 DIAIGVDSAKFGLTEVKLGLVPAVISPYVIAAIGLRQSRRLFLTGELFDASTAQRIGLLH 180 Query: 184 ESYPAEVLDQQVEQWIDNLLLNSPAAMRASKELLREVGNGALTPALRRYTENA--IARIR 241 + AE LD + + P A +K L V A R ENA IAR+R Sbjct: 181 QCVRAEELDDALAGVLAAFAKAGPVAQAQAKRLALRVAGQDQAQAERIDRENAELIARLR 240 Query: 242 VSPEGQEGLRAFLQKRAPNWQAES 265 VS EGQEGL AFL KRA W A++ Sbjct: 241 VSAEGQEGLGAFLDKRAAAWTAQA 264 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 264 Length adjustment: 25 Effective length of query: 247 Effective length of database: 239 Effective search space: 59033 Effective search space used: 59033 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory