Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate N515DRAFT_1894 N515DRAFT_1894 NAD+ synthase (glutamine-hydrolysing)
Query= BRENDA::B3IVI7 (264 letters) >FitnessBrowser__Dyella79:N515DRAFT_1894 Length = 543 Score = 99.0 bits (245), Expect = 2e-25 Identities = 83/239 (34%), Positives = 118/239 (49%), Gaps = 27/239 (11%) Query: 1 MRIALYQGAPKPLDVPGNLQRLRHQAQLAAERGAQLLVCPEMFLTGYNIG--LAQVERLA 58 +R+AL Q V N R+ A + GA L+V PE+ L+GY L + LA Sbjct: 4 LRLALAQFDFPVGAVAANAARVGDLLAQARDGGADLVVYPELTLSGYPPEDLLLRPSFLA 63 Query: 59 EAADGPAAMTVVEIAQAHRIAIVYGYPERGDDGAIYNSVQLI-------DAHGRSLSNYR 111 +A+ A + +A + G+P +G +YN+ L+ AH ++L NY Sbjct: 64 ACDSELSALA----AATNGVAALVGHPH--SEGEVYNAASLLRQGRVELTAHKQALPNYG 117 Query: 112 KTHLFGELDRSMFSPGADHFPVVELEGWKVGLLICYDIEFPENARRLALDGAELILVPTA 171 D+ F PG + V +EG VGLLIC D+ PE A + A GAELI+V Sbjct: 118 VFD-----DKRYFRPGHET-AVATIEGVTVGLLICEDVWQPEPAAQAARAGAELIVV--I 169 Query: 172 NMTPYDFTCQV----TVRARAQENQCYLVYANYCGAEDEIEYCGQSSIIGPDGSLLAMA 226 N +P+D Q +RARAQE C L+Y N G +DE+ Y G S ++ DGS+ A A Sbjct: 170 NASPWDGAKQAEREAVLRARAQETGCALIYLNLVGGQDEVVYDGGSLLVNGDGSVAARA 228 Lambda K H 0.322 0.139 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 543 Length adjustment: 30 Effective length of query: 234 Effective length of database: 513 Effective search space: 120042 Effective search space used: 120042 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory