Align histidine transport ATP-binding protein hisP (characterized)
to candidate N515DRAFT_2043 N515DRAFT_2043 putative ABC transport system ATP-binding protein
Query= CharProtDB::CH_003210 (257 letters) >FitnessBrowser__Dyella79:N515DRAFT_2043 Length = 230 Score = 129 bits (325), Expect = 4e-35 Identities = 91/233 (39%), Positives = 131/233 (56%), Gaps = 17/233 (7%) Query: 6 LNVIDLHKRYGEH----EVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGS 61 + V DL K Y EVL ++L GD ++++G SGSGK+T L I L+ P+ GS Sbjct: 7 IEVRDLSKVYERGKQKVEVLHHINLNIAEGDFLALMGPSGSGKTTLLNLIGGLDSPTGGS 66 Query: 62 IVVNGQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVL 121 I V GQ I+ QL + R + VFQ +NL +T NV E P+ + Sbjct: 67 IGVGGQRID-------QLGAGALAKWRA--ANVGFVFQFYNLMPMLTAQRNV-ELPLLLT 116 Query: 122 GLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTS 181 LS + R+ A L VG+DER+ K P LSGGQQQRV+IARA+ +P +L+ DEPT Sbjct: 117 KLSAAQRRKNAAIALQLVGLDERSSHK-PSELSGGQQQRVAIARAIVSDPTLLVCDEPTG 175 Query: 182 ALDPELVGEVLRIMQQL-AEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEE 233 LD + +VL +++ L E GKT+V+VTH+ A + + H + L +G + E+ Sbjct: 176 DLDRQSAEDVLGLLRTLNREHGKTIVMVTHDPKAAEY-ANHTLHLDKGTLVEQ 227 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 230 Length adjustment: 23 Effective length of query: 234 Effective length of database: 207 Effective search space: 48438 Effective search space used: 48438 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory