Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate N515DRAFT_1410 N515DRAFT_1410 methionine aminotransferase
Query= SwissProt::P58350 (410 letters) >FitnessBrowser__Dyella79:N515DRAFT_1410 Length = 381 Score = 161 bits (407), Expect = 3e-44 Identities = 114/367 (31%), Positives = 175/367 (47%), Gaps = 28/367 (7%) Query: 46 LGAGEPDFDTPEHVKQAASDAIHRGETKYTALDGTPELKKAIREKFQRENGLAYEL-DEI 104 LG G PDF+ P+ +++A + A+ G +Y G P L++ I K +R G + E+ Sbjct: 30 LGQGFPDFEPPQALREAIARAMAEGRNQYAPGIGLPTLREQIALKTERMYGRRIDAAGEV 89 Query: 105 TVATGAKQILFNAMMASLDPGDEVIIPTPYWTSYSDIVHICEGKPVLIACDASSGFRLTA 164 TV +GA + LF A+ A + GDEVI+ P + SY ++ + K V I S F + Sbjct: 90 TVTSGATEALFAAIAAVVRAGDEVIVFDPAYDSYEPVIELQGAKAVHIPLTVPS-FGVDW 148 Query: 165 EKLEAAITPRTRWVLLNSPSNPSGAAYSAADYRPLLEVLLRHPHVWLLVDDMYEHIVYDG 224 +++ A+TPRTR +L+NSP NPSGA SAAD L ++R + +L D++YEHIV+DG Sbjct: 149 QRVRDAVTPRTRMILINSPHNPSGAVLSAADL-DQLAAIVRDTEIVVLSDEVYEHIVFDG 207 Query: 225 FRFVTPAQLEPGLKNRTLTVNGVSKAYAMTGWRIGYAGGPRELIKAMAVVQSQATSCPSS 284 + + L R++ V+ K Y TGW++GYA P L V T C Sbjct: 208 ALHQSVLR-HAELAARSIVVSSFGKTYHCTGWKLGYAVAPAALSAEFRKVHQYLTFCTFH 266 Query: 285 ISQAASVAALNGPQDFLKERTESFQRRRDLVVNGLNAIDGLDCRVPEGAFYTFSGCAGVL 344 +Q A + + E +Q +R D + F G Sbjct: 267 PAQVAFAEFMASTPEHYLELPAFYQAKR----------DRFRALIAPSRFKLLDVPGGYF 316 Query: 345 GKVTPSGKRIKTDTDFCAYLLEDAHVAVVPGSAFGLSPFF---------RISYATSEAEL 395 V S R + D FC +L++ VA +P L+PF+ R+ +A S+A + Sbjct: 317 QLVDYSAIRDEPDVTFCEWLVKQGGVAAIP-----LAPFYETAPDTRLVRLCFAKSDATM 371 Query: 396 KEALERI 402 A ER+ Sbjct: 372 DAAAERL 378 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 381 Length adjustment: 31 Effective length of query: 379 Effective length of database: 350 Effective search space: 132650 Effective search space used: 132650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory