GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lysP in Dyella japonica UNC79MFTsu3.2

Align The lysine specific transporter, LysP of 488 aas and 12 TMSs (characterized)
to candidate N515DRAFT_2630 N515DRAFT_2630 amino acid/polyamine/organocation transporter, APC superfamily

Query= TCDB::K7VV21
         (488 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_2630 N515DRAFT_2630 amino
           acid/polyamine/organocation transporter, APC superfamily
          Length = 454

 Score =  304 bits (779), Expect = 4e-87
 Identities = 173/457 (37%), Positives = 263/457 (57%), Gaps = 40/457 (8%)

Query: 9   TEMQVKRGLKSRHVSMIALGGTIGTGLFLTSGDVIHTAGPFGALTAYVLIGAMVYFLMTS 68
           T   ++RGL+ RH+ ++ALG  IG GLFL S + I  AGP   L +Y+L G  ++ +M +
Sbjct: 3   TNDSLQRGLQERHIRLMALGSAIGVGLFLGSANAIRLAGP-AILLSYLLGGVAIFIIMRA 61

Query: 69  LGEMATYLPTSGSFSDYGTRYVDPAFGFALGWNYWLNWAITVAVDLTAVALCIKFWLPDV 128
           LGEMA   P +GSFS Y   Y+ P  G+  GWNYW  W +T   ++TAV + +  W PDV
Sbjct: 62  LGEMAVQNPVAGSFSRYAQDYLGPLPGYLTGWNYWFMWLMTCIAEITAVGVYMGVWFPDV 121

Query: 129 PSWIFSLIALIIVFSINALSVKTFGETEYWLSAIKITVVVLFLI-IGFLSIFGIMGGHID 187
           P WI++L AL+ + ++N  +VK +GE E+W + IK+  +VL ++  G + +FG+      
Sbjct: 122 PQWIWALAALVTMGAVNLAAVKAYGEFEFWFAMIKVVTIVLMIVGGGAMIVFGL------ 175

Query: 188 VAKNLSVGNHGFVGGLGSFTTGG--------GILGVLLVAGFSFQGTELLGITAGEAENP 239
                  GN G   G+ +  T G        G+L  L +  F++ G E++G+TAGEA+NP
Sbjct: 176 -------GNQGVPTGISNLWTHGGFMPNGAKGMLMALQMVMFAYLGVEMIGLTAGEADNP 228

Query: 240 EKSIPKAMNSIFWRILVFYILSIFVMAAIIPFTDPHLVGGNSAAQSPFTIVFERVGFSIA 299
           +KSIP A+NS+FWRIL+FY+ ++FV+ +I P+ +    G      SPF + FER+G   A
Sbjct: 229 KKSIPDAINSVFWRILIFYVGALFVIMSIYPWNELGTHG------SPFVMTFERLGIKSA 282

Query: 300 ASIMNAVVLTSVVSAANSGMYASTRMLYSLAKDGGAPTIFSKTSKNGIPFIALLATTAVA 359
           A I+N VVLT+ +S+ N G+Y++ RML++LA+ G AP  F+ TS +GIP  A+L  + VA
Sbjct: 283 AGIINFVVLTAALSSCNGGIYSTGRMLFNLAQQGQAPRTFAVTSPSGIPNRAVL-VSLVA 341

Query: 360 LL--TFLTSIYGVSFFTFLVSASGLTGFIAWIGIAISHFRFRRAYVAQGKDVKKLPYHAK 417
           LL    L  +     F ++ SA+       W  + I+  ++RR      +   +L +   
Sbjct: 342 LLFGVLLNYLVPAKVFVWVTSAATFGAIWTWGIVLITQMKYRRGLSEAQR--SQLVFRMP 399

Query: 418 LFPFGPILALIMTVLVT--LGQDP----MLLFGKTWV 448
            FP+   LAL   VLV   +G  P     L+ G  W+
Sbjct: 400 FFPYASYLALAFLVLVVGLMGYFPDTRVALIVGPLWL 436


Lambda     K      H
   0.326    0.141    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 589
Number of extensions: 37
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 488
Length of database: 454
Length adjustment: 33
Effective length of query: 455
Effective length of database: 421
Effective search space:   191555
Effective search space used:   191555
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory