Align D-2-hydroxyglutarate dehydrogenase (EC 1.1.99.39) (characterized)
to candidate N515DRAFT_1999 N515DRAFT_1999 D-lactate dehydrogenase
Query= BRENDA::Q8N465 (521 letters) >FitnessBrowser__Dyella79:N515DRAFT_1999 Length = 456 Score = 183 bits (465), Expect = 1e-50 Identities = 130/424 (30%), Positives = 200/424 (47%), Gaps = 25/424 (5%) Query: 106 PRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGI 165 P + E+ ++R C E + + +G T G +VPV ++ S RMNR+L + + Sbjct: 47 PTSHEQTEALVRACREHRVPLVARGRGTNTTGATVPVDGGVVASFERMNRILRIDPDNRL 106 Query: 166 LVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLG 225 V + G + +L + ++ F P D + C IGGN+A N+ G R ++YGS LG Sbjct: 107 AVVEPGVLNGDLQQALKPHGFFWPPDPTSSPWCSIGGNLACNSAGPRTVKYGSPRENTLG 166 Query: 226 LEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKP---RAVNVA 282 L V G C T K +TGYDL +L IGSEGTL +IT ++ PKP R + Sbjct: 167 LRAVAGTGVGFRCGTYTSKGSTGYDLTRLLIGSEGTLALITEATLKLTPKPSGLRTLRAT 226 Query: 283 FLGCPGFAEVL-----QTFSTCKGMLGEILSAFEFMDAVCMQLVGRHLHLASPVQESPFY 337 + A + Q + C A EF+D V ++L H + PV + Sbjct: 227 YRDVSAAARAVARIMAQPVTPC---------ALEFIDDVALKLARDHGGDSVPVAGAMLM 277 Query: 338 VLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKMLWALRERITEA-LSRD 396 + ++ E + A G GL +A + + LW+ R+ ++ A + Sbjct: 278 IEVDGEPDTLAGAVEAVS---RAARGDGL-ESLQVAQSAEETQALWSARKALSPAQRTIS 333 Query: 397 GYVYKYDLSLPVERLYDIVTDLRARLGPHAKHVVGYGHLGDGNLHLNVTA--EAFSPSLL 454 D+ +PV RL ++V ++A H +V +GH G+GNLH+N+ EA Sbjct: 334 PNKINEDVVVPVSRLPELVDGIKALAAKHDVLIVSFGHAGNGNLHVNLLPRDEAERERAH 393 Query: 455 AALEPHVYEWTAGQQGSVSAEHGVGFRKRDVLGYSKPPGALQLMQQLKALLDPKGILNPY 514 A L V+ G++S EHG+G KR+ + + P L LM+ +KA DP GILNP Sbjct: 394 ACL-AEVFALVIRLDGTLSGEHGIGLVKREFMPLALQPETLGLMRGVKAAFDPDGILNPR 452 Query: 515 KTLP 518 K LP Sbjct: 453 KLLP 456 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 612 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 521 Length of database: 456 Length adjustment: 34 Effective length of query: 487 Effective length of database: 422 Effective search space: 205514 Effective search space used: 205514 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory