GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ydiJ in Dyella japonica UNC79MFTsu3.2

Align D-2-hydroxyglutarate dehydrogenase (EC 1.1.99.39) (characterized)
to candidate N515DRAFT_1999 N515DRAFT_1999 D-lactate dehydrogenase

Query= BRENDA::Q8N465
         (521 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_1999 N515DRAFT_1999
           D-lactate dehydrogenase
          Length = 456

 Score =  183 bits (465), Expect = 1e-50
 Identities = 130/424 (30%), Positives = 200/424 (47%), Gaps = 25/424 (5%)

Query: 106 PRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGI 165
           P + E+   ++R C E  + +  +G  T   G +VPV   ++ S  RMNR+L     + +
Sbjct: 47  PTSHEQTEALVRACREHRVPLVARGRGTNTTGATVPVDGGVVASFERMNRILRIDPDNRL 106

Query: 166 LVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLG 225
            V + G +  +L + ++   F  P D  +   C IGGN+A N+ G R ++YGS     LG
Sbjct: 107 AVVEPGVLNGDLQQALKPHGFFWPPDPTSSPWCSIGGNLACNSAGPRTVKYGSPRENTLG 166

Query: 226 LEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKP---RAVNVA 282
           L  V   G    C T   K +TGYDL +L IGSEGTL +IT  ++   PKP   R +   
Sbjct: 167 LRAVAGTGVGFRCGTYTSKGSTGYDLTRLLIGSEGTLALITEATLKLTPKPSGLRTLRAT 226

Query: 283 FLGCPGFAEVL-----QTFSTCKGMLGEILSAFEFMDAVCMQLVGRHLHLASPVQESPFY 337
           +      A  +     Q  + C         A EF+D V ++L   H   + PV  +   
Sbjct: 227 YRDVSAAARAVARIMAQPVTPC---------ALEFIDDVALKLARDHGGDSVPVAGAMLM 277

Query: 338 VLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKMLWALRERITEA-LSRD 396
           + ++          E +      A G GL     +A    + + LW+ R+ ++ A  +  
Sbjct: 278 IEVDGEPDTLAGAVEAVS---RAARGDGL-ESLQVAQSAEETQALWSARKALSPAQRTIS 333

Query: 397 GYVYKYDLSLPVERLYDIVTDLRARLGPHAKHVVGYGHLGDGNLHLNVTA--EAFSPSLL 454
                 D+ +PV RL ++V  ++A    H   +V +GH G+GNLH+N+    EA      
Sbjct: 334 PNKINEDVVVPVSRLPELVDGIKALAAKHDVLIVSFGHAGNGNLHVNLLPRDEAERERAH 393

Query: 455 AALEPHVYEWTAGQQGSVSAEHGVGFRKRDVLGYSKPPGALQLMQQLKALLDPKGILNPY 514
           A L   V+       G++S EHG+G  KR+ +  +  P  L LM+ +KA  DP GILNP 
Sbjct: 394 ACL-AEVFALVIRLDGTLSGEHGIGLVKREFMPLALQPETLGLMRGVKAAFDPDGILNPR 452

Query: 515 KTLP 518
           K LP
Sbjct: 453 KLLP 456


Lambda     K      H
   0.321    0.139    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 612
Number of extensions: 25
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 521
Length of database: 456
Length adjustment: 34
Effective length of query: 487
Effective length of database: 422
Effective search space:   205514
Effective search space used:   205514
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory