GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glk in Dyella japonica UNC79MFTsu3.2

Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate N515DRAFT_0593 N515DRAFT_0593 glucokinase

Query= curated2:Q2W5F9
         (321 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_0593 N515DRAFT_0593
           glucokinase
          Length = 353

 Score =  208 bits (530), Expect = 1e-58
 Identities = 123/323 (38%), Positives = 175/323 (54%), Gaps = 8/323 (2%)

Query: 6   LVADIGGTHARFALMGPDGEAVNPVVL------RCADYDGPAPAIKAYLAEHAGGVAPKG 59
           L AD+GGTHAR  L+    +   PV +       CA++      +K ++++  G V    
Sbjct: 21  LAADVGGTHARIGLVSQRPDGARPVTVLQYHRYACAEWPSLTAVLKDFVSQLGGAVQVDQ 80

Query: 60  GAFAVASVIDGDRIELTNSPWRFSIAETRQAVGLQRLEVVNDFTAVALSVRHLKPEHLMS 119
            A A A  + GD I   N PW  SI + R ++G++RL VVNDF AVA + + L       
Sbjct: 81  CAVASAGYVLGDAIVNDNLPWPVSIRDIRDSLGIERLAVVNDFEAVAYATQFLVHADTTP 140

Query: 120 VGGGMPEAGL-PIAVLGPGTGLGVSALIPSASGEWTALATEGGHVTMAAATEREARILDR 178
           V       G+ P+ V+GPGTGLG + L+P      T LATE G + ++   ERE  IL  
Sbjct: 141 VIEAQTPGGVGPVLVMGPGTGLGSAVLLPGKPHA-TVLATEAGQIALSPGNEREIEILRV 199

Query: 179 LRTQFDHVSAERVLSGQGLVNLYQAVAALSGHQAVFSTPDVITKRGLDGSCPVSREAVEV 238
           L  +  +VS E  LSG GL+NLY+A+  L G   V + P  IT+  LD S   + EA+EV
Sbjct: 200 LAGERPYVSFEHALSGPGLLNLYRALCVLRGQSPVLAKPSEITRAALDASDAAAVEALEV 259

Query: 239 FFAMMGTVAGNLALSLGAKGGVFIAGGILPRMAEAFRLSSFRTRFEAHGRFQPYLAAIPT 298
           F  ++G+  G+L L  GA+GGVF+AGGILP++ +    SSFR RF   G  + +L  +P 
Sbjct: 260 FCGLLGSFVGDLTLLYGARGGVFLAGGILPQIRDVLLTSSFRERFFNKGVMRAFLQQVPV 319

Query: 299 WLITHPLPAFVGLAGLVTDPKNA 321
            L+ H     +G AG+  +   A
Sbjct: 320 RLMEHGQLGVIGAAGMYLEGHTA 342


Lambda     K      H
   0.320    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 379
Number of extensions: 22
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 321
Length of database: 353
Length adjustment: 28
Effective length of query: 293
Effective length of database: 325
Effective search space:    95225
Effective search space used:    95225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate N515DRAFT_0593 N515DRAFT_0593 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00749.hmm
# target sequence database:        /tmp/gapView.8917.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00749  [M=315]
Accession:   TIGR00749
Description: glk: glucokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
    9.2e-72  227.9   0.0    1.1e-71  227.7   0.0    1.0  1  lcl|FitnessBrowser__Dyella79:N515DRAFT_0593  N515DRAFT_0593 glucokinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dyella79:N515DRAFT_0593  N515DRAFT_0593 glucokinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  227.7   0.0   1.1e-71   1.1e-71       1     315 []      21     333 ..      21     333 .. 0.95

  Alignments for each domain:
  == domain 1  score: 227.7 bits;  conditional E-value: 1.1e-71
                                    TIGR00749   1 lvgdiGGtnarlalvevapgeieqv.....ktyssedfpsleavvrvyleeakvelkdpikgcfai 61 
                                                  l++d+GGt+ar++lv   p  +++v     + y + ++psl+av++ + ++    ++   + ++a 
  lcl|FitnessBrowser__Dyella79:N515DRAFT_0593  21 LAADVGGTHARIGLVSQRPDGARPVtvlqyHRYACAEWPSLTAVLKDFVSQLGGAVQV-DQCAVAS 85 
                                                  79*************999999999988877889*****************98777765.46889** PP

                                    TIGR00749  62 atPiigdfvrltnldWalsieelkqelalaklelindfaavayailalkeedli.qlggakveesa 126
                                                  a+ ++gd +   nl W +si +++ +l++++l ++ndf avaya + l + d + ++++  +   +
  lcl|FitnessBrowser__Dyella79:N515DRAFT_0593  86 AGYVLGDAIVNDNLPWPVSIRDIRDSLGIERLAVVNDFEAVAYATQFLVHADTTpVIEAQTPGGVG 151
                                                  ***********************************************999888747888899999* PP

                                    TIGR00749 127 aiailGaGtGlGvatliqqsdgrykvlageGghvdfaPrseleillleylrkkygrvsaervlsGs 192
                                                  ++ ++G+GtGlG a l++ ++ +  vla+e g + ++P +e ei +l++l  +   vs e  lsG+
  lcl|FitnessBrowser__Dyella79:N515DRAFT_0593 152 PVLVMGPGTGLGSAVLLP-GKPHATVLATEAGQIALSPGNEREIEILRVLAGERPYVSFEHALSGP 216
                                                  ******************.9999******************************************* PP

                                    TIGR00749 193 GlvliyealskrkgerevsklskeelkekdiseaalegsdvlarralelflsilGalagnlalklg 258
                                                  Gl ++y+al   +g+  v        k+ +i++aal+ sd+ a +ale+f+++lG++ g+l+l  g
  lcl|FitnessBrowser__Dyella79:N515DRAFT_0593 217 GLLNLYRALCVLRGQSPV------LAKPSEITRAALDASDAAAVEALEVFCGLLGSFVGDLTLLYG 276
                                                  *********998865443......35999************************************* PP

                                    TIGR00749 259 arGGvyvaGGivPrfiellkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315
                                                  arGGv++aGGi+P++ + l +ssfr++f +kG ++++l+++Pv+++ + + G++Ga+
  lcl|FitnessBrowser__Dyella79:N515DRAFT_0593 277 ARGGVFLAGGILPQIRDVLLTSSFRERFFNKGVMRAFLQQVPVRLMEHGQLGVIGAA 333
                                                  *******************************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (315 nodes)
Target sequences:                          1  (353 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.12
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory