Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate N515DRAFT_2043 N515DRAFT_2043 putative ABC transport system ATP-binding protein
Query= reanno::psRCH2:GFF857 (371 letters) >FitnessBrowser__Dyella79:N515DRAFT_2043 Length = 230 Score = 123 bits (309), Expect = 4e-33 Identities = 72/221 (32%), Positives = 120/221 (54%), Gaps = 11/221 (4%) Query: 4 VTLRDICKSYDG----TPITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGD 59 + +RD+ K Y+ + HI+L+I +G+F+ +GPSG GK+TLL LI GL+ T G Sbjct: 7 IEVRDLSKVYERGKQKVEVLHHINLNIAEGDFLALMGPSGSGKTTLLNLIGGLDSPTGGS 66 Query: 60 LLIDNQRVNDLPP------KDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRR 113 + + QR++ L + +VG VFQ Y L P +T N+ L L + + ++ Sbjct: 67 IGVGGQRIDQLGAGALAKWRAANVGFVFQFYNLMPMLTAQRNVELPLLLTKLSAAQRRKN 126 Query: 114 VEAVAEILQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMR 173 +++ LD+ KP +LSGGQ+QRVAI R +V +P + + DEP +LD + Sbjct: 127 AAIALQLVGLDERSSHKPSELSGGQQQRVAIARAIVSDPTLLVCDEPTGDLDRQSAEDVL 186 Query: 174 IEIARLHQRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQ 214 + L++ T++ VTHD +A A+ + L+ G + + Sbjct: 187 GLLRTLNREHGKTIVMVTHDP-KAAEYANHTLHLDKGTLVE 226 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 230 Length adjustment: 26 Effective length of query: 345 Effective length of database: 204 Effective search space: 70380 Effective search space used: 70380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory