Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate N515DRAFT_1562 N515DRAFT_1562 sulfate transport system ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__Dyella79:N515DRAFT_1562 Length = 384 Score = 202 bits (513), Expect = 2e-56 Identities = 117/274 (42%), Positives = 162/274 (59%), Gaps = 11/274 (4%) Query: 24 FNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIAMVF 83 F+L+IA+GEF+ L+GPSG GKS+ LR+LAGL++ G + D+ + + RDI +VF Sbjct: 21 FSLDIAEGEFVALLGPSGSGKSSLLRILAGLDDPDRGDVLRDGTDLLALPAQRRDIGLVF 80 Query: 84 QNYALYPHMTVGENMGFALKIAGK----SQDEINKRVDEAAATLGLTEFLERKPKALSGG 139 Q+YAL+PHMTV +N+ F L++ + S+ +I RV++ + L E R P LSGG Sbjct: 81 QHYALFPHMTVADNIAFGLRVRPRARRPSRRDIAARVEDLLRRVQLEELGRRYPTQLSGG 140 Query: 140 QRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQTEA 199 QRQRVA+ RA+ P + L+DEP LDA++R R + LQR LG+TTV VTHDQ EA Sbjct: 141 QRQRVALARALAVEPSLLLLDEPFGALDAQVRGTLRVWLRDLQRSLGLTTVLVTHDQDEA 200 Query: 200 LTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNLGTFSVKDGDATSGHAR 259 L + DR+ V+ G ++QVGAP E+Y PA FV GF+G A + +D GH+ Sbjct: 201 LELADRVVVMNRGRIEQVGAPSEIYREPATPFVHGFVGR-ANRIRGHVERDRLHLGGHSF 259 Query: 260 IKLSPETLAAMTPEDNGRITIGFRPEALEIIPEG 293 P LA I RPE L + G Sbjct: 260 QGELPGDLAGR------EIEAWLRPEHLALASRG 287 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 384 Length adjustment: 30 Effective length of query: 346 Effective length of database: 354 Effective search space: 122484 Effective search space used: 122484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory