Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate N515DRAFT_4212 N515DRAFT_4212 multiple sugar transport system ATP-binding protein
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__Dyella79:N515DRAFT_4212 Length = 364 Score = 311 bits (798), Expect = 1e-89 Identities = 180/374 (48%), Positives = 233/374 (62%), Gaps = 23/374 (6%) Query: 1 MATVTFKDASLSYPGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDG 60 MA V YP V + + EIADGE LVLVGPSGCGK+T LRM+AGLE+++ G Sbjct: 1 MAKVRLDKLRKVYPNG-HVGVAEASFEIADGELLVLVGPSGCGKTTLLRMIAGLESISGG 59 Query: 61 AIFIGDKDVTHVAPRDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAA 120 + IG++ V +AP+DRDIAMVFQNYALYPHMTV EN+GF LK+ G+ + EI +RV EAA Sbjct: 60 TLSIGERVVNDIAPKDRDIAMVFQNYALYPHMTVAENLGFGLKLRGQPKAEIERRVAEAA 119 Query: 121 ATLGLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAA 180 L L + L+ +P ALSGGQRQRVA+GRA+VR+P+VFL+DEPLSNLDAKLR+ R +IA Sbjct: 120 RMLELEQRLDSRPAALSGGQRQRVALGRALVRDPKVFLLDEPLSNLDAKLRLSMRVEIAR 179 Query: 181 LQRKLGVTTVYVTHDQTEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPA 240 + ++L T VYVTHDQ EA+T+G RI VL G +QQ+ P LYD PAN+FVAGF+GSPA Sbjct: 180 IHQRLKATMVYVTHDQIEAMTLGQRIVVLNGGVIQQIDTPMNLYDTPANLFVAGFLGSPA 239 Query: 241 MN-LGTFSVKDGD----ATSGHARIKLSPETLAAMTPEDNGRITIGFRPEALEIIPEGES 295 MN L +DG G + P+ A D I +G RPE L + ++ Sbjct: 240 MNLLRGILYRDGGWKLAMPQGELVLGELPQGAALEAWRDRD-IVVGLRPEDLLLC--ADA 296 Query: 296 TDLSIPIKLDFVEELGSDSFLYGKLVGEGDLGSSSEDVPESGQIVVRAAPNAAPAPGSVF 355 ++ +L+ VE +G++ FL + G+L +V R P PAPGS Sbjct: 297 AGAALAAQLEVVEPVGNEVFLN---LRHGELA-----------LVSRMPPRELPAPGSTL 342 Query: 356 HARIVEGGQHNFSA 369 H H F A Sbjct: 343 HFGFAPERLHFFDA 356 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 364 Length adjustment: 30 Effective length of query: 346 Effective length of database: 334 Effective search space: 115564 Effective search space used: 115564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory