Align Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 (characterized)
to candidate N515DRAFT_1906 N515DRAFT_1906 alpha,alpha-trehalose phosphorylase
Query= SwissProt::P77366 (219 letters) >FitnessBrowser__Dyella79:N515DRAFT_1906 Length = 1036 Score = 179 bits (453), Expect = 2e-49 Identities = 95/202 (47%), Positives = 133/202 (65%), Gaps = 4/202 (1%) Query: 3 LQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHGGK 62 LQ VIFDLDGVI DTA +H AW+++A E G+ DA E LKG+ R SL +L+ G+ Sbjct: 807 LQAVIFDLDGVIADTAVVHDAAWRRLAQETGLPFDASIGERLKGVDRMGSLDILLERAGR 866 Query: 63 EGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAP 122 ++++E+ L RKN Y ++ + +LPG R+ +A +RA + VGLAS S NAP Sbjct: 867 A--YSAEEKLALGERKNDYYREQIQRFGPDQLLPGARAAIAAVRAAGLKVGLASASRNAP 924 Query: 123 TILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINA 182 +L L + F + DA+ ++ SKPDPEIFLAA AGLGV P AC+G+EDA AG+ +I+A Sbjct: 925 LLLERLGVAHLFDYIVDAAHIQRSKPDPEIFLAAAAGLGVAPAACLGVEDAAAGVASIHA 984 Query: 183 SGMRSVGIG--AGLTGAQLLLP 202 +GM +VGIG + L A+ +LP Sbjct: 985 AGMAAVGIGQPSALAQAETVLP 1006 Lambda K H 0.320 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 27 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 1036 Length adjustment: 33 Effective length of query: 186 Effective length of database: 1003 Effective search space: 186558 Effective search space used: 186558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate N515DRAFT_1906 N515DRAFT_1906 (alpha,alpha-trehalose phosphorylase)
to HMM TIGR01990 (pgmB: beta-phosphoglucomutase (EC 5.4.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01990.hmm # target sequence database: /tmp/gapView.1894.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01990 [M=187] Accession: TIGR01990 Description: bPGM: beta-phosphoglucomutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-72 229.6 0.0 1.2e-71 226.6 0.0 2.1 2 lcl|FitnessBrowser__Dyella79:N515DRAFT_1906 N515DRAFT_1906 alpha,alpha-treha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dyella79:N515DRAFT_1906 N515DRAFT_1906 alpha,alpha-trehalose phosphorylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.4 0.0 0.028 0.028 10 45 .. 668 703 .. 666 708 .. 0.92 2 ! 226.6 0.0 1.2e-71 1.2e-71 1 187 [] 807 993 .. 807 993 .. 0.99 Alignments for each domain: == domain 1 score: 0.4 bits; conditional E-value: 0.028 TIGR01990 10 GvitdtaeyhylawkkladelgiefdeelnesLkGv 45 Gvi+ + + +aw+ d+l + +d + ++ +Gv lcl|FitnessBrowser__Dyella79:N515DRAFT_1906 668 GVIAAEVGLAAKAWRYFQDSLRVDLDDSHGNAAHGV 703 999999********************9999998888 PP == domain 2 score: 226.6 bits; conditional E-value: 1.2e-71 TIGR01990 1 lkaviFDlDGvitdtaeyhylawkkladelgiefdeelnesLkGvsReesleailkkakkkyseee 66 l+aviFDlDGvi+dta h aw++la+e g++fd ++ e+LkGv R+ sl+++l++a+++ys+ee lcl|FitnessBrowser__Dyella79:N515DRAFT_1906 807 LQAVIFDLDGVIADTAVVHDAAWRRLAQETGLPFDASIGERLKGVDRMGSLDILLERAGRAYSAEE 872 58**************************************************************** PP TIGR01990 67 keelaerknekYvellkeltpedvlpgikelleelkkkkikialasasknaklvleklelkdkfda 132 k +l erkn++Y+e ++ + p+++lpg ++ ++ ++++++k++lasas+na+l+le+l++++ fd+ lcl|FitnessBrowser__Dyella79:N515DRAFT_1906 873 KLALGERKNDYYREQIQRFGPDQLLPGARAAIAAVRAAGLKVGLASASRNAPLLLERLGVAHLFDY 938 ****************************************************************** PP TIGR01990 133 ivdaaevkkgkPdPeiFlaaaeklgvspeecigieDaeaGieaikaagilavgvg 187 ivdaa+++++kPdPeiFlaaa+ lgv+p++c+g+eDa+aG+ +i+aag+ avg+g lcl|FitnessBrowser__Dyella79:N515DRAFT_1906 939 IVDAAHIQRSKPDPEIFLAAAAGLGVAPAACLGVEDAAAGVASIHAAGMAAVGIG 993 *****************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (187 nodes) Target sequences: 1 (1036 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 22.31 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory